KEGG   Yersinia similis: BF17_02660
Entry
BF17_02660        CDS       T03057                                 

Definition
(GenBank) conjugal transfer protein
Organism
ysi  Yersinia similis
SSDB
Motif
Pfam: YAcAr
Other DBs
NCBI-ProteinID: AHK18386
LinkDB
Position
complement(500295..501062)
AA seq 255 aa
MNRSPRFTLQKAQLLKRLPYTVAALVLVVGSNSAHANLASNVTDYSSALETLQEKSVQLQ
SRQNPRQWGLSDVEWQKYLQLQQGKRGVQSPGLDPLTMLGVESETSAERRRLAELWVKEE
YQRTEKELAFQREVNAAWNRLYSGVLSVNMGSTGSIVPDSRGRLALFVRDNCARCDVRLA
ALLTNNSAVDIYLVGSDGKDGSVRQWAASRNIPVDRVRAGQVTLNHDRGLWRQYGQGQMP
VILRKGENGWLIAAF
NT seq 768 nt   +upstreamnt  +downstreamnt
ttgaatcgctccccacgctttacgcttcaaaaagcgcaattactgaaacgcctcccttac
accgttgcagcactggttttagtcgtcggttcgaattctgcccacgcgaatttggcaagt
aatgtcacggattacagttcagcacttgaaacgttgcaggaaaaatcagtacagcttcag
tccagacagaatccccggcagtgggggctaagtgatgttgaatggcaaaaatatctgcaa
ttacagcaaggtaagcgtggcgtacagtcaccggggctggatcctctgacgatgcttggt
gtggaaagtgaaacgtcagcagagcgtcgtcgtttggctgaactttgggtgaaagaagaa
tatcagcggacagagaaagaactggcatttcaacgtgaggtcaacgccgcctggaatcgc
ctctattcgggggtgttgtcggtaaatatggggagtacgggcagtatcgtacccgatagc
cgtggtcggctggcgctgtttgtccgtgataactgcgctcgttgtgacgtcaggctggct
gcgcttctcaccaataatagcgccgttgatatttacctggtaggcagcgacggaaaagat
ggctcagtacgtcaatgggctgccagccgaaatattccagtggatagagtgagggccgga
caggtcactctaaatcacgatcgcggtttatggcgacaatacggtcaaggccaaatgccc
gttattctgcgaaaaggggagaatggatggctaatcgcagcattctga

DBGET integrated database retrieval system