KEGG   Yersinia similis: BF17_06600Help
Entry
BF17_06600        CDS       T03057                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ysi  Yersinia similis
Pathway
ysi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ysi01100  Metabolic pathways
ysi01110  Biosynthesis of secondary metabolites
ysi01130  Biosynthesis of antibiotics
ysi01230  Biosynthesis of amino acids
Module
ysi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF17_06600 (aroK)
Enzymes [BR:ysi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BF17_06600 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_22 AAA_16 TsaE APS_kinase ABC_tran AAA_25 AAA_5 AAA_7 AAA_28 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_PrkA His_biosynth ATPase_2 AAA_29 Mg_chelatase RsgA_GTPase AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: AHK19020
UniProt: A0A0T9PCK2
LinkDB All DBs
Position
complement(1333879..1334400)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggtcgtcagttagctcagcaactcaatatggagtttttcgactctgatcaagaaattgag
cgacgtaccggagctgacgtgggctgggtattcgacgtggaaggcgaagaaggtttccgc
gatcgtgaagaaaaagtgattaatgaactaacggaaaagcaaggcattgttctggcaacc
ggtggtggctctgttaaatccagagaaacccgtaaccgtttgtcagcccgtggggttgtg
gtgtatttagaaaccactatcgagaagcagttagcccgtacacaacgagacaaaaagcgt
ccgttgctacaggtcgatgaacctccacgtgaagtgttagaagcactggcaaaagaacgt
aatccgttatacgaagaaattgcagatgtcactatccgcactgacgatcaaagcgcgaaa
gtggttgctaaccagattatcaacatgctggaaagtaactga

DBGET integrated database retrieval system