KEGG   Yersinia similis: BF17_12085Help
Entry
BF17_12085        CDS       T03057                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ysi  Yersinia similis
Brite
Enzymes [BR:ysi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BF17_12085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHK19965
LinkDB All DBs
Position
2543485..2544144
Genome map
AA seq 219 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMTDMASMNDKDSMNNKASMNDMAGMNDKASMNDMVG
MNNKASMTVKINESLPQGNGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCA
PGMKDGKAVPALAAGGHFDPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLK
SLSEVKQHALMIHAGGDNYSDHPMPLGGGGARMACGVIE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattactgctacctgttattctttactccagcgcaacattggccgct
aacatggccggtatgactgatatggccagcatgaatgataaggacagtatgaataataag
gctagcatgaatgatatggctggcatgaatgataaggctagcatgaatgatatggttggc
atgaataataaggctagcatgactgtgaagatcaatgaatcattgccacaggggaatggg
aaagcgcttggcacagtgacggtgactgagaccgcttatggcttactgtttacgccgcat
ctcactgggctggcaccggggattcacggttttcatctgcatgaaaaacccagttgtgct
ccggggatgaaagatggcaaggccgtgccggcattggcagcaggggggcattttgaccca
aataagaccggggtacaccttggtccttacaacgataaagggcatctgggggatctgccg
ggattggtggttaatgcagatggcaccgccacatatcccgtattggctccgcgcctgaaa
tcgttgtcagaggtgaaacagcatgcgttaatgatccatgctggcggtgataattactct
gatcatccaatgcctttaggcggtggtggcgcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system