KEGG   Yersinia similis: BF17_12245Help
Entry
BF17_12245        CDS       T03057                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
ysi  Yersinia similis
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BF17_12245
Enzymes [BR:ysi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BF17_12245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 FAM72 IpgD
Motif
Other DBs
NCBI-ProteinID: AHK19996
UniProt: A0A0T9R1G5
LinkDB All DBs
Position
2577347..2578462
Genome map
AA seq 371 aa AA seqDB search
MSDENLKGAQMAEGIPETMRAVVAYGPRDYRFEIVPVPTIDAKEILVKVEGCGICAGDTK
AFEGAPSFWGDDKQPAYIKAPMIPGHEFIGHVVGLGADVEGFELGDRVTSEQIVPCWGCR
FCNHGQYWMCEKHDLYGFQSNVNGAMAEYLKFTKEAINYHVPDHLPLEKAILIEPYACAF
HAVQRAKIKLGDVVVLAGSGTLGLGMIGAIKKSGAAKLIVLDLSDDRLALAKKFGADLVL
NPSRDDVNTLIKEMTGGYGCDIYIDATGAQKAVEQGLTLLRKLGTFVEFSVFKDPVTVDW
SIISDRKELDVLGSHLGPYCFPLVIEGISNGDLPTEGVVTHILPLEKYAEGIELVKRGVD
SLKVVLNPNIT
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaaaaccttaaaggtgctcaaatggcggagggtatccccgagacaatgcgt
gcagttgttgcctatgggccgcgcgattatcggtttgaaatagtgccggttccgactatc
gatgccaaagagatcttggtcaaagttgaagggtgtggcatctgtgccggggacaccaag
gcttttgagggggcccccagtttctggggtgatgataagcaacctgcttatatcaaagcg
ccaatgattccaggccatgaatttattggtcacgtcgttggtttgggcgctgatgttgag
gggtttgagctaggtgaccgagtgacttctgagcaaatcgttccctgctggggatgtcgg
ttttgtaaccatgggcagtactggatgtgcgaaaaacatgatctgtacggcttccagagc
aatgttaatggcgcgatggctgaatatctgaaattcacgaaagaggcaattaattatcat
gtccctgatcaccttcctttagaaaaagccattctgattgaaccctatgcctgcgcattt
cacgcggtacagcgtgccaagataaaactcggtgatgtggtggttttggccggatcagga
acattagggctaggcatgattggggctattaaaaagtctggggctgccaagctcattgtg
ctggatttatcggatgatcgtttggctctcgccaagaagtttggcgctgatttggtgctt
aatcccagcagagatgatgtaaataccctgattaaagaaatgaccggtggttatggttgc
gatatctacattgatgccactggtgcgcaaaaggccgttgaacaaggattaactctgctg
cgcaagttggggacgtttgttgaattctcggtatttaaagatcccgtgaccgttgattgg
agcatcatcagtgaccgtaaggaacttgatgtcttggggtcacatctggggccatattgc
ttcccgctagtgatcgaaggtatctctaacggtgatttaccgaccgagggagttgtcacg
catatcttgccattggagaaatatgccgagggtattgagttggtcaaaagaggcgttgac
tcacttaaagtggttctcaatcccaatataacgtaa

DBGET integrated database retrieval system