KEGG   Yersinia similis: BF17_15480Help
Entry
BF17_15480        CDS       T03057                                 

Definition
(GenBank) bicyclomycin/multidrug efflux system
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
ysi  Yersinia similis
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ysi02000]
    BF17_15480
Transporters [BR:ysi02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BF17_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AHK20545
LinkDB All DBs
Position
3251776..3252975
Genome map
AA seq 399 aa AA seqDB search
MQKNRTSHIGLIFILGLLSMLMPLAIDMYLPSMPIIAQEFGVESGRVQMTLSAYVLGFAI
GQMFYGPMADSIGRKPVIFWGTLIFALAGMACALVQSVEQLINMRFLHGLSAAAASVVIN
ALMRDMFTKDEFSRMMSFVVLVMTIAPLLAPIIGGALLVWFSWHAIFWTMAGAALVGAVL
VALFIQETLPPERRQKFHLRTTMGNFGSLFRHKRVLSYMLASGFSFAGMFSFLSAGPFVY
IELNGVSPQNFGYYFALNIVFLFLMTFINSRNVRRFGALKMFRFGLIVQFVMGIWLVVVC
VTGMGFWALVLGVAAYVGCIAMITSNAMAVILDDFPHMAGTASSLAGTLRFGIGAVVGTL
LSMASSRSAWPMVSSMAFCIIVAMLLYLYASRPSNKTAS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaaaaccggacatcccacatcggtttgatttttatccttgggttgttgtcgatg
ctgatgcctttggcgattgatatgtatctgccaagcatgccgattattgcacaggagttt
ggggtcgagagtggccgtgtgcagatgactctgagcgcgtatgtgctggggtttgccatt
gggcaaatgttctatgggccaatggctgacagcatcgggcgtaagccggtcattttttgg
gggacgctgatttttgcgcttgcaggtatggcatgtgcactggtgcagtcggttgagcaa
ctcattaatatgcgcttcctgcatggcttatccgccgccgctgcaagtgtggtgattaat
gcattgatgcgcgatatgttcaccaaagatgagttctcccgaatgatgtcttttgtggtc
ttggtgatgacgattgcacccctgctggcaccgattatcggtggtgcgctgttggtgtgg
tttagctggcatgctattttctggaccatggcgggggcggcactggttggtgcggtgtta
gtggcgctatttatccaagaaacattgccccctgaacggcgacagaaatttcatctgcgt
acgaccatgggtaatttcggctcgttatttcgccataaacgcgtgctgagctatatgttg
gccagtggtttctccttcgccggtatgttttcattcctcagcgccggcccttttgtttat
atcgagttaaacggcgtttccccgcaaaactttggttattactttgcactgaacattgtc
tttttgttcttgatgacctttatcaacagccgtaatgtgcgccgtttcggggcgctgaaa
atgttccgttttggcctgatagtgcaatttgtgatggggatctggctggtggtagtttgt
gtaactggcatgggattctgggcattggttctgggcgtagccgcctatgttgggtgtatc
gcaatgatcacgtctaacgcaatggcggtgatattagatgatttcccgcatatggcaggt
actgcctcttctttggcggggacgttacgctttggtatcggtgcggtggtggggacgtta
ctgtcgatggcttcgtcgcgcagtgcctggccgatggtcagttcaatggcattttgtatt
attgtcgcgatgttgctgtatctgtatgccagtcgcccaagtaataaaaccgcgtcataa

DBGET integrated database retrieval system