KEGG   Yersinia similis: BF17_19835Help
Entry
BF17_19835        CDS       T03057                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
ysi  Yersinia similis
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ysi03016]
    BF17_19835
Enzymes [BR:ysi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BF17_19835
Transfer RNA biogenesis [BR:ysi03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BF17_19835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AHK21267
LinkDB All DBs
Position
complement(4125655..4127589)
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHTQTPRVEGVVKGTEKGFGFLEVDGQKSYFIPPPQMKKVMHGDRI
IATLHTDKDREIAEPETLVEPFLSRFVGRVQRKDDRLSIVPDHPLLRDAIQCRPVRELTH
SFQNGDWAVAEMCRHPLRGDRAFQADLTAFITNGEDHFVPWWVTLARHNLEREAPAMVES
ALNDAELEREDLTALNFVTIDSASTEDMDDALFVQDNGDGSWLLTIAIADPTAYVVENSE
LDLTARKRAFTNYLPGFNIPMLPRDLSDNLCSLRPNERRPVLVCRVTITAEGALSNDIRF
SAAWVESKAKLVYDDVSDWLEGNNRWQPQDTAIAEQITLLKRICDARSNWRQQHALVFKD
RPDYRFLLGEKGEVLDIIVEHRRIANRIVEECMIAANVCAALALRDHLGFGIYNVHTGFD
PALVEQAASVLEANGVEADPQALLTLPGFCELRRHLDALPTQFLDSRIRRFQTFAEISTV
PGPHFGLGLEAYATWTSPIRKYGDMVNHRLLKAIITGQQAEKPQEEITVQLAERRRLNRM
AERDVGDWLYARYLQPQAGTDTRFTAEIIDITRGGLRVRLLDNGAVAFIPAPFIHAVRDE
VVCSQETGTVQIKGETVYSQSDKIEVRIAEVRMETRNVIARPVV
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagataacccgctgctggcgcagctaaaacagcaacttcacactcagacccca
cgcgttgaaggcgtcgttaaaggtactgagaaaggctttggctttcttgaggtagatggg
cagaaaagttactttattccgcctccgcagatgaagaaggtcatgcacggcgatcgcatt
attgccaccctgcatacggataaggatcgtgaaattgctgaacctgaaacattggttgag
ccatttttatcccgctttgttggccgggtgcaacgaaaagatgatcgtctgtctatcgtg
cccgatcaccctttattgcgtgatgctattcaatgccgcccagtacgtgaactgacgcat
agcttccaaaacggtgattgggctgtggctgagatgtgtcggcatccattaagaggtgat
cgcgcctttcaggctgacctgaccgcgtttattaccaatggtgaagaccacttcgttcct
tggtgggtaacgctggcccgccataacctcgaacgcgaagcccctgcgatggtcgaatcg
gccttaaatgacgcagagcttgagcgtgaagacttaaccgcgctcaattttgtcactatc
gacagtgccagcaccgaagatatggatgatgcgctgtttgtccaagacaatggcgatggt
tcatggttattgaccattgccattgctgacccaacagcttacgtcgtcgaaaacagtgaa
ttggatttaaccgcacgtaagcgcgcttttaccaattatctgccgggctttaatatcccg
atgcttccgcgtgatttgtccgacaacctctgttcactgcgcccaaatgaacgccgccca
gtgttggtttgccgtgtgacgatcacagcagagggcgcgttaagtaacgatattcgcttc
tctgccgcttgggttgaatcaaaagccaaactggtttacgacgatgtctctgactggttg
gaagggaacaatcgctggcagccacaagataccgctattgcagagcagattacgttgctg
aaacgtatctgtgacgcccgtagcaactggcgtcaacaacatgcgctggtatttaaagac
cgcccagattaccgcttcctgttgggtgaaaaaggcgaagtactggatatcattgttgag
catcgccgtatcgccaaccgcattgtagaagagtgtatgattgcggcaaacgtctgtgcg
gcactggcgttacgggatcacctcggttttggtatttataacgtgcataccggttttgac
ccagcattagtcgaacaagcggctagcgtactggaagccaatggtgttgaggccgatcct
caagccctactgacgttacccggtttctgtgagttacgccgtcaccttgatgctctgcca
acacagttcctcgacagccgtattcgccgcttccagacgtttgctgaaattagcactgtc
cccggtccgcattttggcctggggcttgaagcctatgccacctggacatctccaatccgt
aaatacggcgatatggtcaatcatcgcctactgaaagcgattattactggtcaacaagca
gaaaaaccgcaagaagagatcacggtccaattggctgaacgtcgccgcctgaatcgcatg
gctgaacgtgatgtcggtgattggttgtatgcccgttatctgcaaccacaagcagggaca
gacactcgcttcacggcagagattattgatatcacccgcggtggcttgcgtgtacgttta
ctggataacggtgcagtggccttcattcctgcgccgtttattcacgcggtgcgtgatgaa
gtggtatgcagccaggaaaccggtacggtgcagatcaaaggcgaaacagtttatagccaa
agtgacaaaatcgaggtgcgcattgcggaagttcgcatggaaacccgtaatgtcattgct
cgtccagtagtctag

DBGET integrated database retrieval system