KEGG   Yersinia similis: BF17_20480Help
Entry
BF17_20480        CDS       T03057                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ysi  Yersinia similis
Pathway
ysi00480  Glutathione metabolism
ysi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BF17_20480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ysi02000]
    BF17_20480
Enzymes [BR:ysi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BF17_20480
Transporters [BR:ysi02000]
 Other transporters
  Pores ion channels [TC:1]
   BF17_20480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AHK21378
UniProt: A0A0T9PHY3
LinkDB All DBs
Position
4274797..4275405
Genome map
AA seq 202 aa AA seqDB search
MKLFYKSGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAKHDYLPGKKFSVADAYLFTVSRWANALNIHITERSHLDQ
YMARVAERPAVKAALAAEDIKQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaatcgggggcttgttctctgtccccccatattgtgttacgggaa
gcaggattagacttcagcattgaacgtgttgatttagtgacaaaaaagacggagacgggt
gcggactatttaagcatcaacccaaaaggacaagtgcctgccttagtactagatgacggc
agcctgcttacggaaggggtggctattgtgcaatatttggcagataaagtccctgaccgc
cacttaattgccccatcagggacgctctcgcgttatcatgccattgagtggctgaatttt
atcgcgactgaattacataaaggttttagcccactatttaatccaaatacaccggatgag
tataagacgattgtccgcgagcggctggataagcaattcagctatgttgatagcgtatta
gcaaagcatgactatctgccaggtaaaaaattcagtgtggcagatgcctacttatttacc
gttagccgttgggctaatgcgctaaatattcacatcacagaacgcagccatttggatcaa
tatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagctgccgaagatatc
aagcaataa

DBGET integrated database retrieval system