KEGG   Yersinia similis: BF17_21115Help
Entry
BF17_21115        CDS       T03057                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ysi  Yersinia similis
Pathway
ysi00473  D-Alanine metabolism
ysi01100  Metabolic pathways
ysi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF17_21115
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF17_21115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ysi01011]
    BF17_21115
Enzymes [BR:ysi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF17_21115
Peptidoglycan biosynthesis and degradation proteins [BR:ysi01011]
 Precursor biosynthesis
  Racemase
   BF17_21115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AHK21490
UniProt: A0A0T9QKJ3
LinkDB All DBs
Position
4405009..4406238
Genome map
AA seq 409 aa AA seqDB search
MHVRFRHLFLLSLITLVACSQPVPKNHLSLTSIPANAQQPVVNNAWLEISQGALDFNTKK
MLTLLDNKSTLCAILKGDAYGHDLILVTPVMLKNNVQCIGVASNQELKTVRDLGFTGQLM
RVRSATLKEMQQAMAYDAEELIGDKTVAEQLNNIAKLNGKVLRIHLALNSGGMSRNGLEV
SKTRGLNDAKTIAGLNNLTIVGIMSHYPVEDASEIKADLARFQQQAKDVIAATGLKREKI
KLHVANTFATLAVPDSWLDMVRVGGVFYGDTIASTEYKRAMTFKSNIASLNNYPKGGTVG
YDRTYTLKRDSLLANIPVGYADGYRRVFSNAGHVIIQGQRLPVLGKTSMNTVMVDVTDLK
KVSLGNEVVLFGKQGNAEIQAEEIEDLSGALFTEMSILWGATNKRILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttcgttttcgtcatttattcttattatcattaataactttggtcgcttgtagc
caacccgtaccaaaaaaccatcttagcctgacctctatacctgccaatgcccagcaacct
gtagtgaataatgcgtggcttgaaatttctcaaggtgcgctggatttcaatactaaaaag
atgcttacactgctggataataaatccacactttgtgcaatattaaaaggtgatgcctat
ggacatgacctgatcttagtcacaccggtgatgctaaaaaacaatgtgcaatgtattggg
gttgccagcaatcaggaactaaaaacggtacgtgacctaggatttactggtcagttgatg
cgggtcagaagtgcaacattaaaagaaatgcaacaagccatggcttacgatgctgaagaa
cttattggcgataaaaccgtcgctgagcagttaaataatattgcaaaactgaatggaaaa
gttctccgtatccatctggcacttaactctggagggatgtcacgtaatgggctggaggtc
agtaagacccgcggtttaaatgacgcaaagacgattgcaggtttaaacaatctaacaatc
gttggcatcatgtcgcactacccggtggaagatgctagcgaaatcaaagcagacttggct
cgattccagcaacaagccaaagatgttatcgcggccacggggctgaaacgtgaaaagatt
aagctccacgtcgccaatacattcgctaccttagcggtgcctgattcatggttggatatg
gtccgtgtgggaggggtgttttatggtgacaccatcgccagcacagaatataagcgggct
atgaccttcaaatctaatatcgcatcactgaacaactaccctaagggcggcactgttggc
tatgaccggacctatacattgaaacgtgattccctgctggctaatatccctgtgggttat
gccgatggatatcgccgagtattcagtaatgcggggcatgtgattattcaaggtcagcgc
ctgcccgtattaggcaaaacatcaatgaatacggttatggtagacgtcaccgatctaaaa
aaagtgagtttaggtaatgaagtagtcttattcggaaagcagggcaatgcagaaatccag
gcagaagaaattgaagatctcagtggggcactatttaccgaaatgtcaattctatggggt
gcaaccaataagcgtattctggtagattaa

DBGET integrated database retrieval system