KEGG   Zhongshania aliphaticivorans: AZF00_03860
Entry
AZF00_03860       CDS       T04315                                 

Definition
(GenBank) 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00362  Benzoate degradation
zal00622  Xylene degradation
zal00643  Styrene degradation
zal01100  Metabolic pathways
zal01120  Microbial metabolism in diverse environments
zal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZF00_03860
   00622 Xylene degradation
    AZF00_03860
   00643 Styrene degradation
    AZF00_03860
Enzymes [BR:zal01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     AZF00_03860
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_4 BAAT_C Esterase
Other DBs
NCBI-ProteinID: AMO67483
UniProt: A0A127M2M0
LinkDB
Position
882484..883320
AA seq 278 aa
MSETNPEMGKRAELRSGYGANYLEAGDKSKPCVILLHGSGPGVTGYANWRLLLPELQNDF
YVLAPDVVGFGYTDHPKNFEYNMDNWLVFVCEFMDAVGVSKAHFVGNSFGGALSLAMAAR
HPERVERFVMMGAAGIHFEITEGLRLVWGYKPSVEAMAELMSVFAYNKNLVSHEIIKSRY
EASIRPGYQDAYEQLFPEPMQEKLNGLCIPEDEIRLINHEALVVHGREDVIVPMENSIKA
HRLLKNSELHTFSQCGHWTQVEKPRAFADLVRNFLMRV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagcgaaacgaatcctgagatgggcaaacgcgcagaactacgtagtggctacggcgca
aattacctagaggccggcgacaagagtaagccctgtgtgatactgctgcacggctcaggc
cccggcgtcactggctatgccaactggcgcttattactgcctgaattgcaaaatgatttt
tatgtcttggcgccagatgtggtgggctttggttacaccgatcaccccaaaaattttgaa
tataatatggataactggttggtctttgtctgtgaatttatggatgccgttggcgtgagc
aaggcgcattttgtgggcaattcctttggcggcgcgctcagcttagcgatggcggcgcgt
caccccgagcgggtcgagcgttttgtgatgatgggtgcggcgggaattcacttcgaaatt
accgaaggtctgcgtttggtgtggggctataagccttcggtcgaagcgatggcagagttg
atgtcggtatttgcctataacaaaaatttagtaagtcatgaaattataaaatcgcggtac
gaggctagtattcgccctggctaccaagatgcctacgaacagttatttcctgagcctatg
caagaaaagctaaatggcttgtgtatacctgaagacgaaatccgcttgattaatcacgag
gcgctcgtcgttcacggccgcgaagacgtcattgtgccaatggaaaattctatcaaggcg
catcgtctattgaaaaattctgaacttcatacctttagccagtgtggtcactggactcag
gtggaaaagccccgcgcctttgccgatctagtgcgaaattttttaatgcgagtttga

DBGET integrated database retrieval system