KEGG   Zhongshania aliphaticivorans: AZF00_04300Help
Entry
AZF00_04300       CDS       T04315                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zal01100  Metabolic pathways
zal01110  Biosynthesis of secondary metabolites
zal01130  Biosynthesis of antibiotics
zal01230  Biosynthesis of amino acids
Module
zal_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZF00_04300 (aroK)
Enzymes [BR:zal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AZF00_04300 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin ABC_tran Cytidylate_kin2 AAA_33 AAA_22 dNK AAA AAA_5 AAA_17 APS_kinase TsaE AAA_16 AAA_29 AAA_24
Motif
Other DBs
NCBI-ProteinID: AMO67564
UniProt: A0A127M2W1
LinkDB All DBs
Position
988310..988843
Genome map
AA seq 177 aa AA seqDB search
MKSGAVFLVGPMGAGKSTIGRLLAETLRFEFCDVDREIEERSGVDIPWIFDMEGEEGFRD
REESMLSELSDGSQVVISTGGGAVLRSVSRKLMVARGTVIYLKTSVEEQVRRTARDRKRP
LLQNGDPGTTLRNLMALREPLYEEIADYTVLTDNRTPKSVVQELCEQLGASDLSAQY
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgggtgcagtatttttagttgggccaatgggggcgggaaagagcactattggc
cgtttgttggcagagaccttgcgttttgaattttgcgatgtcgatcgtgagatagaagag
cgtagcggtgtggatattccttggatcttcgatatggaaggtgaagagggatttcgtgat
cgtgaagagagtatgctgtctgagttgagtgatggctctcaagtggttatttctactggt
ggcggtgcggtattgcgcagtgtgagccgtaagttgatggtcgctagaggcacggtgatt
tatcttaaaacctcagtggaggagcaggtgcgacgtaccgctcgggatcgcaagcgtcca
ctgttgcaaaatggtgatcccggtacaaccctgcgaaacttaatggccctgcgtgaacct
ctctacgaagaaattgccgattacacggtattaacggataatcgcactccgaagtcagtt
gttcaggaattgtgtgagcagctcggcgccagcgacctcagcgcgcaatattga

DBGET integrated database retrieval system