KEGG   Zhongshania aliphaticivorans: AZF00_10720Help
Entry
AZF00_10720       CDS       T04315                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00020  Citrate cycle (TCA cycle)
zal00270  Cysteine and methionine metabolism
zal00620  Pyruvate metabolism
zal00630  Glyoxylate and dicarboxylate metabolism
zal00680  Methane metabolism
zal01100  Metabolic pathways
zal01110  Biosynthesis of secondary metabolites
zal01120  Microbial metabolism in diverse environments
zal01130  Biosynthesis of antibiotics
zal01200  Carbon metabolism
Module
zal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
zal_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:zal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZF00_10720
   00620 Pyruvate metabolism
    AZF00_10720
   00630 Glyoxylate and dicarboxylate metabolism
    AZF00_10720
  Energy metabolism
   00680 Methane metabolism
    AZF00_10720
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AZF00_10720
Enzymes [BR:zal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AZF00_10720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AMO68737
UniProt: A0A127M6A7
LinkDB All DBs
Position
2411607..2412587
Genome map
AA seq 326 aa AA seqDB search
MKQPVRVTVTGAAGQIGYALLFRIASGAMLGDDQPVILHLLDITPAMDALQGVRMELEDC
AFPLLAGVVCTDDPNVGFKDADYALLVGARPRGPGMERKDLLEANAAIFSVQGKAIDQNA
SKNIKVLVVGNPANTNALIAQRNAPSISPRNFTAMTRLDHNRAMTQIAIKTGKTVNDVTN
MTIWGNHSATQYPDLFNAKVSGQTASDLVDQAWLEGDFIPTVQQRGAAIIKARGASSAAS
AANAAIGHVRSWALGTEGDDWVSMGVYSDGSYGIAEGLIYSFPCRCKDGEWEIVQGLEVN
DFSRAKMQASEQELAEERDGVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccagttcgcgtcaccgttaccggtgcagccggccaaattggctacgcttta
cttttccgcatcgcctctggcgctatgctgggcgacgatcagcccgttattttacaccta
ctcgacatcactccagccatggacgccctgcaaggcgtgcgcatggaactggaagattgc
gccttcccattattggctggcgtagtttgcaccgacgatccaaatgttggctttaaagat
gccgactacgccctgctggttggcgcacgtccacgtggcccaggcatggagcgtaaagac
ttgcttgaagctaacgcggcaatcttctctgttcaaggtaaagccattgaccagaatgcc
agcaagaacatcaaagtattggttgttggcaaccccgctaacaccaacgccctgatcgcc
cagcgcaacgcgccgtctatcagcccacgcaacttcactgccatgacgcgcttggatcac
aaccgcgccatgactcagattgccatcaaaaccggcaaaactgtgaacgacgtgaccaac
atgaccatttggggcaaccactctgctactcagtacccagacctgttcaacgccaaggtc
tctggccagactgcaagtgacttggttgaccaagcgtggctcgaaggcgatttcatcccg
actgttcagcagcgcggtgcagcaatcatcaaagcccgtggcgcttcttctgctgcttct
gcggctaacgctgcaatcggtcacgtgcgcagctgggcactgggcaccgaaggcgacgac
tgggtttctatgggtgtttacagtgacggcagctacggcattgccgaaggcctgatctac
tcattcccttgccgctgcaaagatggcgagtgggaaattgttcaaggtcttgaagttaac
gacttcagccgcgcaaaaatgcaagcttctgagcaagaactggccgaagagcgcgacggc
gtaaaacacttacttccttaa

DBGET integrated database retrieval system