KEGG   Zhongshania aliphaticivorans: AZF00_16990Help
Entry
AZF00_16990       CDS       T04315                                 

Definition
(GenBank) hypothetical protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
zal  Zhongshania aliphaticivorans
Brite
KEGG Orthology (KO) [BR:zal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zal03016]
    AZF00_16990
Enzymes [BR:zal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     AZF00_16990
Transfer RNA biogenesis [BR:zal03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    AZF00_16990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 OB_RNB S1
Motif
Other DBs
NCBI-ProteinID: AMO69892
UniProt: A0A127M9H2
LinkDB All DBs
Position
3815546..3817435
Genome map
AA seq 629 aa AA seqDB search
MLDKNALQQLRQLKTHIVETKDQGEGEVRGSQRRFGFVRLDDNRDVFLAPDDMQRVFPGD
RVKITVHTDDKGKFKAELEKLIDSPLDCFTGRYVVRGQGHFVEPDLPRFNKLLFIPPSQR
KKCAEGDLLYCQVAQHPFKDGKSQVKVLENIGSPDQPGIEGKYTQRKFKLPRDWPASCGI
TEDKYLDGREDLRDLPFVTIDSAETRDLDDALWAQSNAQGWLLKVAVADPGAVIAPGSPT
DIAAKQRASSVYLPGFTQPMIPNSISQGACSLLADEDRAAIVCTLQVGIDGDISDIQFSE
ALIRSHAKLSYTDVHAHIHGKMDLGYPALNELYAASQALNRYRREHHIVMPEQADFHFQL
NEHRKIEAIIKVERNDAHRLVEECMLAANRSVAEWLGDAPALFVSHAGLREDRLDNVRKV
IAKELPELIDCDISSLEGYKALIKACDASESSLPLRSIFARMLQPGSISAEPKPHFGLGL
ERYSTFTSPLRKYSDLIVQRCIRAKLRGESIQRPDEETATSLQEALRNGRQASNQMEQWL
QYQYLATNTSDTVYPARIAHVNGGGFTVELVDYGISGFVEARTITEKLSFDADTLRLHSA
HSNYQLEQIVNVKVSELDDFQRKLMFILA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaaaaatgccctgcagcaactccgccaactcaaaactcatattgttgaaacc
aaagaccaaggtgagggcgaagttcgcggcagtcaacgccgcttcggttttgttcgcctc
gacgacaaccgcgatgtatttctggcgccagacgatatgcagcgggtatttcccggtgat
cgcgtaaagattacggtgcacaccgacgacaagggcaaatttaaagccgagctggaaaaa
ctgatcgacagcccactggactgtttcaccggtcgttatgtggtgcggggccagggccat
tttgtagaacccgacttgccgcgctttaacaaattgctgtttattccgccttcacagcgg
aaaaaatgcgccgaaggcgatctcctgtactgccaagtggcacagcacccctttaaagac
ggcaaatcccaagtaaaggtacttgaaaatatcggcagtcccgatcaacccggtatcgaa
ggcaaatacactcagcgcaaattcaaactgcctagagactggcccgcgagctgcggtata
accgaagataagtacttagacggccgcgaagatctgcgggatttaccgtttgtcaccatc
gactcggcagaaacccgtgacctagacgacgcgctatgggctcaaagcaatgcgcaaggc
tggttgctaaaagttgccgttgccgatcctggcgcggtaatagcgccgggcagcccgact
gatatcgccgccaaacaacgcgccagcagcgtttacctgccaggctttacccagccgatg
atacccaatagcatttcgcagggcgcctgctcactgctcgctgacgaagatcgcgccgcg
attgtctgcaccctgcaggttggtattgatggcgatattagtgacattcaatttagcgag
gcgctgatccgttcccacgccaagctaagttacaccgatgtacacgcccatattcacggc
aaaatggatttaggctacccagcactaaacgagctttacgccgccagccaagccttaaac
cgctatcgccgcgaacatcacattgtgatgccagaacaagcagacttccattttcagctc
aacgagcaccgtaaaatcgaagccattattaaagttgagcgcaacgacgcccaccgattg
gtggaggagtgcatgcttgccgctaaccgcagtgtggcggaatggttaggcgacgcccca
gcactgttcgtaagccacgcgggtttgcgtgaagaccgtctcgacaatgtacgcaaagtg
atcgccaaagaattacctgagctgattgattgcgacataagcagcctagagggttataaa
gccctcattaaagcctgtgacgcgagcgaatccagcctcccactgcgcagtatatttgcc
cgcatgcttcagcccggcagcattagtgctgagccaaagccccatttcggccttggccta
gaacgctacagcacgtttacctcgccactgcgcaaatacagcgaccttatagtacagcgc
tgtattcgcgccaagcttcgcggcgaaagcattcagcgcccagatgaagaaaccgcaacg
agcttacaagaagccctgcgcaacggccgtcaagccagcaatcagatggagcagtggctg
caataccagtaccttgccacgaacactagcgacacggtttacccggcccgcattgcccac
gtcaatggcggtggtttcaccgtagaattggtagattacggtattagcggctttgttgag
gcccgcaccattaccgaaaaattaagcttcgacgccgacaccctgcgcctgcacagtgcc
cacagcaattatcagctagagcagatcgtgaatgtaaaggtatctgagctcgatgatttt
cagcgtaagttgatgtttatcctggcctga

DBGET integrated database retrieval system