KEGG   Zhongshania aliphaticivorans: AZF00_17200Help
Entry
AZF00_17200       CDS       T04315                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
zal  Zhongshania aliphaticivorans
Brite
KEGG Orthology (KO) [BR:zal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZF00_17200
Enzymes [BR:zal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AZF00_17200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 DAO FAD_oxidored Thi4 NAD_binding_8 FAD_binding_3 Glutaredoxin AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AMO69930
UniProt: A0A127M9M8
LinkDB All DBs
Position
complement(3855281..3856876)
Genome map
AA seq 531 aa AA seqDB search
MLDAKMKTQLEAYLQNLKTPVELVAYLDGQDKSRELETLMNEVSALSPLVSLVEGDDQDA
RRPAMGVRSVASGTEMRFAGVPLGHEFTSLVLAVLHSGGHPMKIDKELIEQVRNLDGEYR
FETYISLSCQTCPEVVQALNMMAAINPQIRNEMIDGAMFQDEVEARKVLAVPTVFMNGQQ
FSQGRISLADILKKMDKNAGARSLKKLAEKDIFDMLVVGGGPAGASAAIYAARKGIRTGV
LADKFGGQLLDTVSIENFISVNETEGPKLVANLEAHVGAYDVDIMAGHQASGLSVADDGS
IEISVEGGAVLRSRSVLLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKSVAVIG
GGNSGIEAAIDLAGITGHVTVLEFDSKLRADEVLQRKARSLKNVDIITSAQTTEVLGDGD
RVIGLAYTDRQSGESKTISLAGIFVQIGLVPNTEFLKGVVDLSPRGEIEIGARGETSVAG
VFAAGDVTTTPFKQIVIAVGSGATAALGAFDYLIRQPVLENSAEQIANQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcgaaaatgaaaacccagttggaggcgtacctccaaaatctaaaaacaccg
gtagagctggtcgcgtatctcgatggccaagataaatcccgggaacttgaaaccctgatg
aacgaggtgtctgcgctatcgccgctggtatcactggttgagggtgacgatcaagatgca
cgtcgacccgctatgggcgtgcgttccgtggccagtggcaccgagatgcgttttgctggt
gtgccgcttggtcacgaatttacctcattggtgttggcggtgctgcacagcggcggccac
cccatgaagatagataaagagctgattgaacaagtgcgcaatcttgacggcgaataccgt
tttgagacctacatttctttgagctgccagacctgcccagaggtggttcaggcgctgaat
atgatggcggcgatcaacccccagattcgcaatgaaatgatcgacggcgcgatgttccaa
gacgaagtggaagcgcgaaaagtgctggcggtgccaaccgtgtttatgaacggccaacag
ttttctcagggccgtattagcttggccgatatcttaaagaagatggacaaaaacgccggt
gcgagaagccttaaaaaactcgccgagaaagacatatttgatatgttagtggttggcggt
ggccccgctggcgcctcggcggcaatctacgcggcccgtaaaggaattcgcacaggcgtg
ttggccgataaatttggcggtcaattattagataccgtgagtatcgaaaactttatttcg
gtgaacgaaaccgaagggccaaaattggtcgccaatctcgaggctcacgttggcgcttac
gatgtggatattatggcgggccaccaagctagcggcttatcggtagctgacgacggcagc
atcgagatcagtgtcgagggtggcgcggtattgcgtagccgttcggtgttgctggcgacc
ggtgctcgctggcgcgaaatgaatgtgccgggcgaacaagaataccgtggtaagggcgtg
gcctactgcccgcactgtgacggcccgctgtttaaaggtaaatcggttgcggtgattggc
ggtggtaactcgggtattgaggccgccatcgaccttgcgggaatcaccggccacgtcacc
gtgttggagtttgacagcaagcttcgcgctgacgaggttttgcagcgcaaggcgcgctca
ctaaagaacgtcgatattatcaccagcgcccaaaccaccgaagtgctaggtgacggcgac
cgagtgattggtttggcgtataccgaccgccaaagcggcgagagcaaaaccattagtctg
gcgggtatctttgtgcagattggtttggtgcccaacaccgagtttttaaaaggggtggta
gaccttagtccgcggggcgaaattgaaattggcgcacgcggtgaaacttcggtggctggt
gtgtttgccgctggcgacgtcaccaccacgccctttaagcagattgtaattgcagtgggc
agtggcgcaaccgccgccttgggcgccttcgactacttgattcgccagccggtgttggaa
aacagcgccgagcaaattgcaaaccaagctgcttaa

DBGET integrated database retrieval system