KEGG   Zobellella denitrificans: AN401_02100Help
Entry
AN401_02100       CDS       T05100                                 

Definition
(GenBank) ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
zdf  Zobellella denitrificans
Pathway
zdf00910  Nitrogen metabolism
zdf02010  ABC transporters
Module
zdf_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AN401_02100
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AN401_02100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zdf02000]
    AN401_02100
Transporters [BR:zdf02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    AN401_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ATG72790
UniProt: A0A291HKS2
LinkDB All DBs
Position
complement(455597..456562)
Genome map
AA seq 321 aa AA seqDB search
MSKPSSTASSSIPKTPWPTWTAWPSRSWPEAARSITMTTQSTSSPTPALARRAPRPAPLG
PVLRYGLNHLAPPLVILAGLLLLWELLCSGSNAALPAPSQVLSDTWELITDPFYNNGGND
VGMAWQILASLERVAYGYSLAVLVGVSLGVLVGQSTWAMRGLDPLFQVLRTVPPLAWLPI
SLAGFQDSSPSAIFVIFITSIWPIIINTSVGVRNIPEDYRNVARVLRLNGLEYFTRIMLP
AAAPYIFSGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAWNASLLSDIVLALIYVGLVG
FILDRIVAVFGQWVSRGTSAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaaccttcttcgacggcaagcagttcgatcccgaaaaccccatggcctacctgg
acagcctggccatcaagaagctggcctgaggccgcaaggagcatcaccatgaccacccaa
agcacttcttccccgactcccgcgctcgcccggcgagcgccccggccggcccccctcggc
cccgtgctgcgctacggcctgaaccacctggcgccccccctggtgatcctggccgggctg
ctgctgctgtgggagctgctgtgctccggcagcaacgccgccctgccggcccccagccag
gtgctgagcgatacctgggagctgatcaccgatcccttttataacaacggcggcaacgac
gtgggcatggcctggcagatcctggccagcctggagcgggtggcctatggctacagcctg
gcggtgctggtgggcgtgagcctgggggtactggtgggccagtccacctgggccatgcgc
ggcctggatcccctcttccaggtgctgcgcaccgtgccgcccctggcctggctgccgatc
tccctggccggctttcaggacagcagcccgtccgccatcttcgtgatcttcatcacctcg
atctggcccatcatcatcaacacctcggtgggggtgcgcaacattcccgaggattaccgc
aacgtggcccgggtgctccggctcaacggcctggaatacttcacccgcatcatgctgccc
gccgcggccccctatatcttctccgggctgcgcatcggggtcggcctgtcgtggctggcc
atcgtcgccgccgagatgctgatcggcggcgtgggcatcggcttctttatctgggacgcc
tggaacgcctcgctgctcagcgacatcgtactggccctgatctacgtgggcctggtgggc
ttcatactcgaccgcatcgtcgcggtcttcggccaatgggtaagccgcggcaccagcgcc
gcctga

DBGET integrated database retrieval system