KEGG   Zobellella denitrificans: AN401_10130Help
Entry
AN401_10130       CDS       T05100                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
zdf  Zobellella denitrificans
Brite
Enzymes [BR:zdf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AN401_10130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATG74168
UniProt: A0A231N3K5
LinkDB All DBs
Position
2173108..2173689
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYAKNALEPHISQETLEYHYGKHHNTYVVNLNNLVPGTEFEGKSLEDIIKTS
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGALADAIKAAFGSFDAFKEEFTKSCVTNFG
SGWTWLVKKADGSVGIVNTSNAGCPLTEGVAPLLTCDVWEHAYYIDYRNVRPDYVKAFWA
LVNWDFVAENFAK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaacttcccgcactgccttacgccaaaaatgctctggaaccccatatctcc
caggaaaccctggaataccactacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggttcccggcaccgagttcgaaggcaaatccctggaagacatcatcaagacttct
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggcactgc
ctgtcccccaacggtggcggcgagccgaccggtgccctggccgacgccatcaaggccgcc
ttcggctccttcgatgccttcaaggaagagttcaccaagtcctgcgtgaccaacttcggc
tccggctggacctggctggtgaagaaggccgacggctccgtgggcatcgtcaacacctcc
aacgccggctgcccgctgaccgagggcgttgccccgctgctgacctgtgacgtctgggag
cacgcctactacatcgactaccgcaacgtgcgccccgactatgtcaaggccttctgggcc
ctggtcaactgggacttcgtggcagaaaacttcgccaagtaa

DBGET integrated database retrieval system