KEGG   Zobellella denitrificans: AN401_10605Help
Entry
AN401_10605       CDS       T05100                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zdf  Zobellella denitrificans
Pathway
zdf03030  DNA replication
zdf03410  Base excision repair
zdf03420  Nucleotide excision repair
zdf03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AN401_10605
   03410 Base excision repair
    AN401_10605
   03420 Nucleotide excision repair
    AN401_10605
   03430 Mismatch repair
    AN401_10605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zdf03032]
    AN401_10605
   03400 DNA repair and recombination proteins [BR:zdf03400]
    AN401_10605
Enzymes [BR:zdf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AN401_10605
    6.5.1.6  DNA ligase (ATP or NAD+)
     AN401_10605
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AN401_10605
DNA replication proteins [BR:zdf03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AN401_10605
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AN401_10605
DNA repair and recombination proteins [BR:zdf03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AN401_10605
   NER (nucleotide excision repair)
    Other NER factors
     AN401_10605
   MMR (mismatch exicision repair)
    Other MMR factors
     AN401_10605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ATG75904
UniProt: A0A291HUS9
LinkDB All DBs
Position
complement(2291922..2292749)
Genome map
AA seq 275 aa AA seqDB search
MPLGLVWVAGEVQGLAPPPLQLAGWYQQQDTALYRVSEKLDGVRAYWNGRELLSRGGHRF
SAPGWFLAGFPATPLDGELWLGRGRFSELSAAVRRFVPLDDEWRQIRFMVFDLPASDLPF
EARLSALQALFATLDTPHLELVEQRRVPDRPALSAWLAEVEAGGGEGLMLRHRQSRYLPG
RNEDLLKLKRHRDAEAVVLAHLPGQGKYEGMLGALLVETPDGRRFRLGTGFSDEQRRRPP
PPGSTVSYRYRGETATGLPRFASFLRVRSDEPGQP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctgggcctggtgtgggtcgccggcgaggtccaggggcttgcgcccccgccgctg
caactggcgggctggtaccagcagcaggacacggccctttaccgggtgagcgaaaagctc
gacggggtgcgcgcctactggaatggccgtgagctgttgtcccgcggtggccaccgcttt
tcggcgccgggctggttcctggccggttttcccgccacgcccctcgacggcgagctgtgg
ctgggtcggggccgcttcagcgagctgtccgccgccgtgcgtcgctttgtccccctcgac
gatgaatggcggcagatccgctttatggtgttcgacctgcctgcaagcgacttgcccttc
gaggcgcggctctcggcgctgcaggccctgttcgccaccctagatacgccccacctcgaa
ctggtggagcagcggcgggtgccggatcggcccgccctgtcggcctggctggcggaagtg
gaggccgggggcggggaggggctgatgctgcgccaccgccaaagccgttacctgccgggt
cgcaacgaggatctgctcaagctcaagcgccaccgggacgccgaggcggtggtgctggcg
cacctgcccggccagggcaaatatgaaggcatgctgggggcactcctggtggaaaccccg
gacggccggcgcttccggctgggcaccggcttcagtgacgagcagcgtcgccggccgcca
ccgccgggcagcaccgtcagctatcgctaccggggcgaaaccgccaccggtctgccgcgc
ttcgccagcttcctgcgggtgagaagcgacgagcccgggcagccttag

DBGET integrated database retrieval system