KEGG   Zobellella denitrificans: AN401_13255Help
Entry
AN401_13255       CDS       T05100                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
zdf  Zobellella denitrificans
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN401_13255
Enzymes [BR:zdf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AN401_13255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO FAD_oxidored HI0933_like Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 K_oxygenase AlaDh_PNT_C FMO-like DUF2190 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ATG74706
UniProt: A0A291HR56
LinkDB All DBs
Position
2853951..2855498
Genome map
AA seq 515 aa AA seqDB search
MLDANLKKQLDTYLQNIVSPIEISVSGDDSPKSKELLELAAEISGLSGNISLKEAAADRT
PSMSVAPAGQAPRVSFAGIPMGHEFTSLVLALLQAGGHPSKASPELLEQIRNLEGQFHFE
TYISLSCQNCPDVVQALNLMATLNPNISHVMIDGALFQDEVNRRQVMAVPAVYLNGEHFG
QGRMSLEEIIGKLDTGAAERKAAALDEKAPYDVLIVGGGPAGAAAAIYAARKGIRTGLVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVREYGVDIITDQRAAGIRRGELIELP
LASGATLRGKAVILATGARWRELKVPGEAEYRTRGVAYCPHCDGPFFKGKRVAVVGGGNS
GIEAAIDLAGIVEHVTVLEFADSLRADEVLQRKARSMGNIDIIMNAQTTAVLGDGSKVTG
MQYTDRVSGDSKRLEVAGIFVQIGLVPNTEFLQGSEVELTRFGEVVIDAKGATSMAGVFA
AGDATTVPYKQIIISMGAGATAALGAFDHLIRAGS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatctcaaaaaacaactggacacctacctgcagaacatcgtctctccg
atagagatcagcgtgtccggtgatgacagccccaaatccaaagaattgctggaactggcc
gccgagatcagcgggctttccggcaacatcagcctcaaggaagccgccgccgaccgcact
cccagcatgagcgtcgcccccgccgggcaggcgccgcgggtaagctttgccggcattccg
atgggccacgaattcacctcgctggtactggccctgctgcaggccggcggccatccgtcc
aaggcctcccccgagttgctggagcagatccgcaacctcgagggccagttccattttgaa
acctacatctccctgtcctgccagaactgtccggacgtggtgcaggcgctcaacctgatg
gcgaccctgaaccccaacatcagccacgtgatgatcgacggcgccctgttccaggacgag
gtgaaccggcgccaggtgatggcggtgcccgccgtctacctgaacggcgaacacttcggc
cagggtcgcatgagcctggaagagatcatcggcaaactcgacaccggcgccgccgagcgc
aaggccgccgccctcgacgaaaaagccccctacgacgtgctgatcgtcggcggaggcccg
gccggtgccgccgccgccatctacgccgcccgcaagggcattcgcaccggcctggtggcc
gagcgcttcggcggccaggtgatggacaccgtcggcatcgaaaacttcatttccgtgccc
tacaccgaaggcccgaagctggccgccagcctggagcagcacgtcagggaatacggggtg
gacatcatcaccgaccagcgtgccgccggcatccgccgcggggagcttatcgagctgccg
ctggccagcggcgccaccctcaggggcaaggcggtgatcctggccaccggggcgcgctgg
cgcgagttgaaggtgcccggcgaggccgaataccgtaccaggggcgtggcctactgcccg
cactgcgacggccccttcttcaagggcaagagggtggcggtggtcggcggcggcaactcg
ggcattgaagcggccatcgatctggccggtatcgtcgaacacgtgaccgtgctggagttc
gccgacagcctgcgcgccgatgaggtgctgcaacgcaaggcccgctccatgggcaatatc
gacatcatcatgaatgcccagaccaccgcagtgctgggcgacggcagcaaggtcaccggc
atgcagtacaccgaccgggtcagcggcgacagcaaacggctggaggtggcgggcatcttc
gtgcagataggcctggtgcccaacaccgagttcctgcagggctcggaagtggagctgacc
cgcttcggcgaggtggtgatcgacgccaagggcgccacctccatggccggggtgttcgcc
gccggcgacgccaccactgtgccctacaagcagatcatcatttccatgggcgccggcgcc
accgccgccctcggcgccttcgaccacctgatccgcgccggctcgtaa

DBGET integrated database retrieval system