KEGG   Zobellella denitrificans: AN401_17850Help
Entry
AN401_17850       CDS       T05100                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
zdf  Zobellella denitrificans
Pathway
zdf00220  Arginine biosynthesis
zdf01100  Metabolic pathways
zdf01110  Biosynthesis of secondary metabolites
zdf01130  Biosynthesis of antibiotics
zdf01210  2-Oxocarboxylic acid metabolism
zdf01230  Biosynthesis of amino acids
Module
zdf_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AN401_17850
Enzymes [BR:zdf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     AN401_17850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ATG75478
UniProt: A0A231N010
LinkDB All DBs
Position
3836077..3837228
Genome map
AA seq 383 aa AA seqDB search
MKSLNLLDLYRSIIALPSISSTDPSWDQSNEQVIRLLADWFSQLGFEVEVTELPDLPGKF
NLLATKGSGDGGLLLAGHTDTVPFDPGRWNKDPFKVTEEGNRLYGLGTIDMKGFFAFIVE
ALKDLDLSKLDKPIRILATADEETTMAGARAIAGAMAIKPDYAVIGEPTGLVPVMMHKGH
MSEAIRITGKSGHSSDPANGLNALEIMHQVMGRLLDLQRQLKEKYANPHFKVPQPTLNLG
HIHGGDSPNRICACCELHFDMRPIPGVGPDELMGLLHHALEPIKEQYPGAVEVSHLHEPI
PAYGTDPEAELVRAAAEITGNPAEAVNYCTEAPFIQQLGCQTIVLGPGHIAQAHQPDEYL
DLSFVTPTVQVLQHLVKRFCFSK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgctcaacttgctggacctgtaccgcagcatcatcgccctgccctccatcagc
agcacggatcccagctgggaccagagcaacgagcaggtgattcgtctgctggcggactgg
ttcagccagctcggcttcgaggtggaagtgaccgaactgcccgatctgcccggcaagttc
aacctgctggccaccaagggcagcggtgacggcggcctgctgctggccggccacaccgat
acggtgcccttcgacccgggccgctggaacaaggaccccttcaaggtcaccgaggaaggc
aaccgcctctatggcctgggcaccatcgacatgaagggcttcttcgcctttatagtagaa
gcgctcaaggatctggatctgagcaagctcgacaagcccatccgcatcctcgccaccgcc
gacgaggaaaccaccatggccggcgcccgggccatcgccggcgccatggccatcaagccc
gactacgcggtgatcggcgagcccaccggcctggtgccggtgatgatgcacaagggccac
atgtcggaagccatccgcatcaccggcaagagcggccacagctcggatccggccaacggc
ctcaacgccctggaaatcatgcaccaggtaatgggccggctgctcgacctgcagcgccag
ctcaaggagaagtacgccaacccccacttcaaggtgccccagcccaccctcaacctgggc
catatccacggcggcgacagccccaaccgcatctgcgcctgctgcgagctgcacttcgac
atgaggcccatccccggggtcggccccgacgaactgatggggctgctgcaccatgccctg
gaacccatcaaggaacagtacccgggcgcggtggaggtgagccacctgcacgagcccatt
cctgcctacggcaccgatccggaggccgagctggtccgggccgccgccgagatcaccggc
aacccggcggaggcggtgaactactgcaccgaggcgcccttcatccagcaactgggctgc
cagaccatagtgctgggccccggccatatcgcccaggcccaccagcccgacgaatacctg
gatctgtccttcgtcacccccaccgtccaggtgctgcaacatctggtcaaacgcttctgt
ttcagtaaataa

DBGET integrated database retrieval system