KEGG   Zobellella denitrificans: AN401_17855Help
Entry
AN401_17855       CDS       T05100                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zdf  Zobellella denitrificans
Pathway
zdf00620  Pyruvate metabolism
zdf00680  Methane metabolism
zdf01100  Metabolic pathways
zdf01120  Microbial metabolism in diverse environments
zdf01200  Carbon metabolism
Module
zdf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:zdf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AN401_17855
  Energy metabolism
   00680 Methane metabolism
    AN401_17855
Enzymes [BR:zdf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AN401_17855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HAMP
Motif
Other DBs
NCBI-ProteinID: ATG75479
UniProt: A0A291HTQ8
LinkDB All DBs
Position
3837341..3839962
Genome map
AA seq 873 aa AA seqDB search
MDNHAALRANVGLLGQLLGDTIKAHHGQAFLDKIETIRQLAKSARQGNQDDQQQLLSTLK
NLSDDELLPVARAFNQFLNLANVAEQFHTISREYQRSAGPSPLHQVFERLKGADIDDNRI
KEAVAALDIELVLTAHPTEVTRRTFIHKHVQLNDCLAALELDLPEPEKAEILARVEQLIA
QAWHSNEIRSLRPTPVDEAKWGFAVIENSLWPALPRFIRQLDQQLHDHLGVRLPLDAAPV
RFASWMGGDRDGNPFVTAKVTREVLLLGRWMASSLFLNDIQELVSELSMSEANRELYIQS
GESDEPYRAVLRRLREDLRETLMHLNARVQGQKTDARDLITSTEQLREPLELCYRSLHEC
GLGLIADGLLLDVIRKVACFGIHLLKLDVRQDGDRHTQALAEITRYLGLGDYAEWSESDK
QAFLLNELNSRRPLLPRQWQPSDDTKEVLDTCRVIAEHPRDAFGIYIISMAGAPSDVLAV
QLLLKEAGVDFPLPVAPLFETLDDLNRGAEVIEQLYALPWYRGYLQGHQYVMIGYSDSAK
DAGMLAAGWAQYSAMEQLVNLSAKEQVKLTLFHGRGGSLGRGGGPARQAILAQPPGSTLG
GLRVTEQGEMIRFKFGLPQVAIDSLALYASAVLEANLLPPPEPEPQWRELMDTMARVSCD
HYRSLIRGEPDFVPYFRAATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAWTQNRL
MLPAWLGAHKGLERAIEDGHESTLVTMNKRWPFFRARLDMLEMVFLKADLGLAAYYDSVL
VPEALKPLGTRLREELKASMDLILQLKEEAELLSDQPWIKESIKLRNPYTDPLNVLQAEL
LKRSRQQGEIHPVLDQALMVTIAGIAAGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggataatcatgcagcactcagggccaacgtcggtctgctggggcagttgttgggcgat
accatcaaggcccaccacggccaggcctttctcgacaagatcgagaccatccgccagttg
gccaagtcggcccggcaaggcaaccaggacgatcagcagcagctgctgagtaccctgaaa
aacctgagtgacgatgagctgctgccggtggcccgcgccttcaaccagtttctgaacctg
gccaacgtggccgagcagttccataccatttcccgggagtaccagcgcagcgccggcccc
agcccgctgcaccaggtgttcgagcgactcaagggcgccgacatcgacgacaaccgcatc
aaggaggcggtggccgccctggacatcgagctggtgctcaccgcccaccccaccgaagtg
acccgccgcacctttatccacaagcacgtgcagctcaacgactgcctggccgccctggag
ctggatctgcccgagccggaaaaagcggagatcctggcccgggtcgaacagctgatcgcc
caggcctggcacagcaacgagatccgctccctgcgccctaccccggtggacgaggccaaa
tggggcttcgcggtgatcgagaacagcctctggcccgccctgccccgcttcattcgccag
ctcgaccagcagttgcacgaccacctgggcgtgcgcctgccgctggacgccgcgccggtg
cgcttcgcctcctggatgggcggcgatcgggacggcaaccccttcgtcaccgccaaggtc
acccgggaagtgctgctgctcggccgctggatggccagctccctgttcctcaacgacatc
caggagctggtgtccgagctgtccatgtcggaagccaaccgcgaactctacatccagagc
ggcgagagcgacgaaccctaccgggcggtgctgcgccggctgcgggaagatctgcgcgaa
accctgatgcacctcaacgccagggtgcagggccagaagaccgacgcccgggatctgatc
accagcaccgaacagctgcgtgaacccctggagctgtgctaccgctccctgcacgaatgc
ggcctggggctgatcgccgacggcctgctgctggacgtgatccgcaaggtcgcctgcttc
ggcatccacctgctcaagctcgacgtccgccaggacggcgaccgccacacccaggccctg
gccgagatcacccgctacctgggcctgggcgactacgccgaatggagcgaatccgacaag
caggccttcctgctcaacgaactcaattcccgccggccgctgctgccgcgccagtggcag
ccctcggacgacaccaaggaggtgctggacacctgcagggtcatcgccgagcacccccgc
gatgccttcggcatctacatcatctccatggccggcgccccctccgacgtgctggcagta
cagctgctgctgaaggaagccggcgtcgacttcccgctgccggtggcgccgctgttcgaa
accctggacgacctcaaccggggcgccgaggtgatcgagcagctgtacgccctgccctgg
taccgcggctacctgcagggccaccagtacgtgatgatcggttattccgattccgccaag
gacgcgggcatgctggccgccggctgggcccagtacagcgccatggaacaactggtgaac
ctgagcgcgaaagagcaggtcaagctgaccctgttccacggccggggcggcagcctgggc
cggggcggcggccccgcccgccaggcgatcctggcgcaaccgcccggctccaccctgggc
ggcctgcgggtcaccgaacagggcgagatgatccgcttcaagttcggcctgccccaggtg
gccatcgacagcctggcgctctacgccagcgccgtgctcgaggccaacctgctgccgccg
ccggagcccgaaccccagtggcgcgagctgatggacaccatggcccgggtatcctgcgat
cattaccgctcgctgatccgcggcgagcccgacttcgtgccctatttccgcgccgccacc
cccgagctggagctgggcaagctgccgctgggctcgcgtccggccaagcgcaagcccaac
ggcggggtggaaagcctgcgcgccatcccctggatcttcgcctggacccagaaccggctg
atgctgcccgcctggctgggcgcccacaaggggctggagcgggccatcgaggacggccac
gaaagcaccctggtgacgatgaacaagcgctggcccttcttccgcgcccgtctggacatg
ctggagatggtgttcctcaaggccgacctgggcctggcagcctactacgacagcgtgctg
gtgccggaagcgctcaagcccctgggcacgcgcctgcgggaagagctgaaggcaagcatg
gatcttatcctgcaactgaaggaagaggccgagctgctctccgaccagccctggatcaag
gaatccatcaagctgcgcaacccctacacggatccgctcaacgtgctgcaggccgaactg
ctcaagcgttcccgccagcagggcgaaatccacccggtgctggaccaggcgctgatggtc
accatcgccggcatcgccgccggcatgcgcaataccggctaa

DBGET integrated database retrieval system