KEGG   Zobellella denitrificans: AN401_18345
Entry
AN401_18345       CDS       T05100                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
zdf  Zobellella denitrificans
Pathway
zdf01040  Biosynthesis of unsaturated fatty acids
zdf01100  Metabolic pathways
zdf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AN401_18345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zdf01004]
    AN401_18345
Enzymes [BR:zdf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AN401_18345
Lipid biosynthesis proteins [BR:zdf01004]
 Desaturase
  First
   AN401_18345
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-ProteinID: ATG76043
UniProt: A0A291HV32
LinkDB
Position
3940028..3941146
AA seq 372 aa
MRKPPLLWTNAILFASTGLAALVLVPWYGLTQGYDGWQWLAMLALFSYSCLSITAGYHRL
WAHKAYDAHPLLQWLFALGGALSLQNSAFRWCADHRRHHRHVDDLDKDPYSAKRGLWFSH
MGWMLRDYHPEDDSNIPDLKRNAVLQFQHRHYLALTLAMNIGLPVLLGLWHGDLWGMLLM
AGVLRLFLGHHVTFFINSLAHYWGRQPYTSKNTARDNDLLAVLTFGEGYHNFHHLFEYDY
RNGIRWWHYDPTKWLIRTLSWVGLARKLRTCPQERIEQARLERRLEVTRQKILRRQQNAD
TEQWLALLHSEYERLLAQLKDYYQVRKSLLELKKKAARCKYEELRLKLSCDELKAAFTTQ
KRNWLKLTTQFA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgcgcaaacctcccctgctctggaccaatgccatcctcttcgccagtaccggactggcg
gccctggtgctggtcccctggtacggcctgacccagggctacgacggctggcaatggctg
gctatgctggctctattcagttacagctgcctgtcgatcaccgccggctaccaccggctg
tgggcccacaaggcctacgacgcccacccgctgctgcaatggctgttcgccctgggcggc
gccctgtcgctgcagaattccgcctttcgctggtgcgccgaccaccgccgccaccatcgc
catgtggacgatctggacaaggacccttactccgccaaacgcggcctgtggttttcccat
atgggctggatgctgcgcgactaccacccggaagacgacagcaatatccccgatctcaag
cgcaacgccgtgctgcagttccagcaccggcattacctggcgctgaccctggccatgaac
atcggcctgccggtgctgctcggcctctggcacggggatctctggggcatgctgctgatg
gccggcgtgctgcgcctcttcctcggccaccacgtcaccttcttcatcaactccctggcc
cattactggggtcgccagccctacaccagcaagaacacggcgcgggacaacgacctgctg
gcggtactgaccttcggcgagggttatcacaacttccatcacctgttcgaatacgactac
cgcaacggcatccgctggtggcactacgatcccaccaagtggctgatccgcaccctgagc
tgggtcggcctggccaggaaactgcgtacctgtccccaggaaaggatcgagcaggcccgg
ctggagcgccggctggaagtgacccgccagaaaatactgcgccggcaacagaatgccgat
accgagcagtggctggccctgctgcacagcgagtacgagcgcctgctggcccagctcaag
gattactaccaggtgcgcaaatccttgctcgagctgaagaaaaaggccgctcgctgcaag
tacgaggaattgcggctcaaactgagctgcgacgagctgaaggccgccttcactacccag
aagcgcaactggctaaagctgaccacccagtttgcctaa

DBGET integrated database retrieval system