KEGG   Zobellia galactanivorans: ZOBELLIA_114Help
Entry
ZOBELLIA_114      CDS       T01586                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
zga  Zobellia galactanivorans
Brite
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ZOBELLIA_114 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 TssD
Motif
Other DBs
NCBI-ProteinID: CAZ94187
UniProt: G0L8V2
LinkDB All DBs
Position
130593..131198
Genome map
AA seq 201 aa AA seqDB search
MKNIKFSLAIVVALTILNCKEAKKDTDGSPDSSNKSLETTGGNLAKTKSQTTDTLTVNMS
SKSNSTVSGTITFVQSGTEVEMKAIFTGLDEGPHAIHLHENADCSSQDGKSAGGHWNPTE
EAHGKWGSEKGYHKGDIGNFTADKEGRATVTFATDEWCIDCNDENKNIIGRSVIVHKGQD
DFTSQPSGDAGSRIACAGITK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaaattcagcttggccatagtagtggccctgacaatactcaattgtaaa
gaagccaaaaaagatacggacggaagtccagacagctcgaacaaaagccttgaaacaaca
gggggaaaccttgcaaaaacgaagtcccaaacaactgacaccctcacggtcaacatgagc
tcaaaaagcaacagcacggtcagcggcacaatcacatttgtacagagtggaactgaagtg
gaaatgaaagccatctttaccggtttggacgaaggaccccacgccatccacttgcacgaa
aatgccgattgctcatcgcaagacggaaagtcggcaggcggacattggaacccaacggag
gaagcccacggcaaatggggttctgaaaaaggctaccacaaaggagatataggcaatttt
acggccgataaggaaggtagggccaccgttacattcgccacggacgagtggtgcattgat
tgtaacgacgagaacaagaatattataggtcggtcagtaatcgtacacaaaggtcaagat
gactttacatcgcaaccaagtggcgatgccggttcacggatagcttgcgcgggaatcacc
aaataa

DBGET integrated database retrieval system