KEGG   Zobellia galactanivorans: ZOBELLIA_1372Help
Entry
ZOBELLIA_1372     CDS       T01586                                 

Gene name
mutY
Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
zga  Zobellia galactanivorans
Pathway
zga03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:zga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    ZOBELLIA_1372 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zga03400]
    ZOBELLIA_1372 (mutY)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     ZOBELLIA_1372 (mutY)
DNA repair and recombination proteins [BR:zga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     ZOBELLIA_1372 (mutY)
 Prokaryotic type
     ZOBELLIA_1372 (mutY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD NUDIX_4 HHH EndIII_4Fe-2S Opy2
Motif
Other DBs
NCBI-ProteinID: CAZ95428
UniProt: G0LAM3
LinkDB All DBs
Position
complement(1622238..1623284)
Genome map
AA seq 348 aa AA seqDB search
MNFSEEILKWYQVNKRSLPWRGSTDPYKIWLSEVILQQTRVVQGIPYYLKFVETYPKVDD
LARASEAEVLKLWQGLGYYSRARNLHAAAKMVSEQYGGVFPETYGGLLGLKGVGDYTASA
IASICFNVPEPVVDGNVYRVLARYFGVDLAINSTEGVKYFKKLAREVMDVGQIRDYNQGI
MEFGAIQCVPKSPDCEVCPLNESCVALQMKRVGDLPLKLKKTKVRSRYFNYIVFVSEDGR
TVLEQRKGKGIWENLWQFPLIESPEKLSPSHFQRYFEGMNHKVDPVSIDLFNPEAIVHKL
SHQHLYTSFWVVRTKELPKNGISFEEADTYPVPVLIADFLRSFKKSYF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttcagaggaaattctcaagtggtaccaagttaataaaaggagcctgccttgg
cgtggttctacggatccctacaagatttggttgtcagaggtcatattacaacaaactcgg
gtggtacagggtattccctactaccttaaatttgttgagacctacccgaaagtagatgat
ttggcccgtgcttcggaggctgaagtcttgaagctttggcaaggtttgggctactattca
agggctagaaacttgcatgccgcggccaagatggtgagtgaacaatatgggggtgttttc
cctgaaacctatggcggattacttgggttaaaaggggtgggcgactatacggcaagcgct
attgcaagcatttgtttcaatgtgcccgaacccgttgtagatggtaatgtttatcgggta
ttggcgcgttacttcggagtcgatttggccatcaatagtaccgaaggtgttaaatatttc
aaaaaattggcgagagaggtgatggatgtgggccaaattagggattataatcagggtatc
atggaatttggggccattcaatgtgtgcctaaaagtcctgattgtgaggtgtgtccgttg
aatgaaagttgtgtggcgcttcaaatgaagcgcgtgggcgatcttccgttaaaattaaaa
aagaccaaggtcaggtcgaggtattttaattacattgtttttgtttccgaagatggtcga
acggtgcttgaacagcgcaaagggaagggaatctgggaaaatttatggcaattcccgctt
atagaatcccccgaaaaactttcgccatcccattttcaacggtattttgaggggatgaac
cataaggtagacccggtttccatagaccttttcaatccagaggccattgttcataaattg
tcgcaccagcatttgtataccagcttttgggtggtacgtacaaaggaacttcctaagaat
ggaatttcgttcgaagaagccgacacataccccgtacccgtgttaattgcagacttttta
agaagctttaaaaaatcgtatttttga

DBGET integrated database retrieval system