KEGG   Zobellia galactanivorans: ZOBELLIA_1468Help
Entry
ZOBELLIA_1468     CDS       T01586                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
zga  Zobellia galactanivorans
Pathway
zga00564  Glycerophospholipid metabolism
zga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ZOBELLIA_1468 (glpD)
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ZOBELLIA_1468 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 GIDA NAD_binding_8 3HCDH_N HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAZ95524
UniProt: G0L3W4
LinkDB All DBs
Position
complement(1744154..1745821)
Genome map
AA seq 555 aa AA seqDB search
MKNIRFSNLDRAKTIAELTSSTYDLVVIGGGITGGGIALDAASRGLKVALVEKGDFASGT
SSKSTKLIHGGLRYLKQFDFWLVKEVGSERAIVHKLAPHLVLPEKMLLPLIENGSYGKWL
TSIGLKVYDILAQVTGDDKRQMLEKKEALKLEPLLPKKILKGAGYYAEYRTDDARLTIEN
IKSSLLFGAQALNYAAVEDFIYEDEKVAGVQVKDGVSGATFNIKSKYVISAAGPWVDELR
STNNSKKGKQLHLTKGVHLVFPKKKLPIKQSVYFDVPDGRMMFAIPRGKVTYIGTTDTNY
NKDKDNVRTDLADAIYLISAVNNMFPDINLEMDDIISSWAGLRPLIHEEGKSASELSRKD
EIFTSDTGLISIAGGKLTGYRKMAERVVDRIAKRMEEEEGTELKECYTEKIFLCGNVDFK
KFKHVEKYISEVYGRIKGDGFTKHDAWFLVTTYGKQTEMILENYEGFSDTDKYVRLAKAE
LRFCIDYEMVQNPMDFFIRRTGRLYFDIDSVRTLMEPILEEFKSIFAVTDEQLVSWRKIL
ENELDEHSNFSLDRG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattaggttttcaaatttggatagggcaaaaacgattgccgagcttacctcc
agcacctacgatcttgtcgttatcggtggaggtattacaggcggggggattgcccttgat
gccgcctcacgtggactcaaagtggccttggtcgaaaaaggggattttgcctccggaacc
agtagtaaatcgaccaaattgatacatggcggactgcgatatttaaagcaattcgatttt
tggctggtaaaggaagtcggatctgaacgtgccatcgtccataaactggcaccacatttg
gtccttcccgaaaaaatgttgcttccccttattgaaaatggttcatacggtaagtggctg
acttcaatcggtctgaaggtatacgacattttggcccaggtaaccggtgacgataagcgt
caaatgcttgagaaaaaagaagctttgaagcttgaacctttgcttccgaagaaaatattg
aaaggcgccggctattatgccgaataccgtaccgatgatgcgcgattgaccattgagaat
atcaagtcgagcctattgttcggggcacaggccttaaactatgccgcggttgaggatttt
atttacgaggatgaaaaagtagcgggggttcaagtaaaagacggggtctcaggggctact
ttcaatattaaatcgaaatacgtgatcagtgctgcgggcccatgggtcgatgaattgcga
agtaccaataactctaaaaaaggaaagcaattacatctgaccaaaggggtgcatttggtc
tttcctaaaaagaaattaccgataaagcaatccgtttattttgatgtgcccgacggtaga
atgatgtttgcaataccgcgcggtaaggtgacctatatcggtactaccgataccaattac
aataaggacaaggataacgttcgcacagacttggccgatgccatctatctcatatccgca
gtgaacaacatgtttcccgatatcaatctggaaatggacgatattatatcatcgtgggca
ggtctgcgtcccttgatccatgaagagggaaaatcggcttccgaactttctagaaaagat
gaaatattcacttccgatacaggcctgataagtattgccggaggtaagcttaccgggtat
aggaaaatggcggaaagggtcgttgatcgcatagccaaaagaatggaagaagaagagggt
accgaactaaaagagtgttataccgagaagatatttctttgtggcaacgtagattttaaa
aagttcaagcatgttgaaaaatacatcagtgaagtttacggccgtatcaaaggggatggt
tttaccaaacacgatgcttggttcttggttaccacctatggaaagcagaccgaaatgatt
ctagaaaattacgaaggttttagcgataccgataaatacgtacgtttggcaaaggccgaa
ctgcgtttctgcatcgactatgaaatggtgcagaatcccatggattttttcattagaaga
acgggccgactgtactttgatattgatagcgtgagaacgctaatggagcctattctggaa
gaatttaaatccatttttgccgtaaccgatgaacaactggtctcatggcgaaagattttg
gaaaacgaattagacgagcattctaatttttccctagatcgtggataa

DBGET integrated database retrieval system