KEGG   Zobellia galactanivorans: ZOBELLIA_1480Help
Entry
ZOBELLIA_1480     CDS       T01586                                 

Gene name
pcdA
Definition
(GenBank) Piperideine-6-carboxylate dehydrogenase, aldehyde dehydrogenase family
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
zga  Zobellia galactanivorans
Pathway
zga00010  Glycolysis / Gluconeogenesis
zga00053  Ascorbate and aldarate metabolism
zga00071  Fatty acid degradation
zga00280  Valine, leucine and isoleucine degradation
zga00310  Lysine degradation
zga00330  Arginine and proline metabolism
zga00340  Histidine metabolism
zga00380  Tryptophan metabolism
zga00410  beta-Alanine metabolism
zga00561  Glycerolipid metabolism
zga00620  Pyruvate metabolism
zga00625  Chloroalkane and chloroalkene degradation
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
Module
zga_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_1480 (pcdA)
   00053 Ascorbate and aldarate metabolism
    ZOBELLIA_1480 (pcdA)
   00620 Pyruvate metabolism
    ZOBELLIA_1480 (pcdA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ZOBELLIA_1480 (pcdA)
   00561 Glycerolipid metabolism
    ZOBELLIA_1480 (pcdA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ZOBELLIA_1480 (pcdA)
   00310 Lysine degradation
    ZOBELLIA_1480 (pcdA)
   00330 Arginine and proline metabolism
    ZOBELLIA_1480 (pcdA)
   00340 Histidine metabolism
    ZOBELLIA_1480 (pcdA)
   00380 Tryptophan metabolism
    ZOBELLIA_1480 (pcdA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ZOBELLIA_1480 (pcdA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ZOBELLIA_1480 (pcdA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZOBELLIA_1480 (pcdA)
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ZOBELLIA_1480 (pcdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAZ95536
UniProt: G0LAT1
LinkDB All DBs
Position
1761931..1763484
Genome map
AA seq 517 aa AA seqDB search
MSHLASQFGIEKALKDLGVMDINHGTSTGSSHFGSGEIISSYSPVDGALIAKVKTTAKED
YEQVMAAATKAFKVWRSKPAPQRGEIVRQFGEKLREKKEALGKLVSYEMGKSYQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHSLGVVGIISAFNFPVAVWAWNTAL
AWICGDVCVWKPSEKTPLCGVACQNIAVEVFKANGLPEGISCLINGDYRVGEMMTTDTRI
PLISATGSTRMGKIVAQNVAARLGKSLLELGGNNAIIVTPDADIKMTVIGAVFGAVGTAG
QRCTSTRRLIIHESIYDQVKTALVEAYKQLRIGNPLDENNHVGPLIDTDAVAHYKNALDK
VVEEGGKIIVDGGVLEGEGYESGCYVKPAIAEAQPDFKIVQHETFAPVLYLLKYSGSVED
AIDIQNNVAQGLSSAIMTNNLREAEYFLSVAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTINYTTELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatttagcatcgcaattcggtatcgaaaaagcacttaaggatttaggtgtaatg
gatataaaccacggtacctcaacaggctcctcacattttggttccggagaaattatttca
tcatactcgccagtagacggggccctgatcgctaaagtcaagacgaccgctaaagaagat
tacgaacaagtgatggccgccgcgaccaaggcctttaaggtatggcgaagcaagccggca
ccgcaacgaggtgaaatcgtaaggcaatttggagaaaagttaagggagaaaaaagaagcc
ttaggcaaattggtatcgtacgaaatgggaaaaagctaccaagaaggcttgggagaagta
caggaaatgatcgacatctgtgactttgccgtaggtctttcgaggcagttgcacggtctt
accatgcattccgaacgcccaggtcaccgaatgtacgagcaatatcattcactgggtgtg
gtcggaattatttcggctttcaactttcctgttgccgtttgggcatggaacacggccttg
gcatggatctgtggtgatgtttgcgtttggaaaccatctgaaaaaacacccttatgcggg
gtggcctgtcaaaatattgccgtagaggtctttaaggccaacggtttgcccgaaggtatt
tcttgcctgatcaacggtgactaccgcgtaggtgagatgatgaccaccgatacacgaatc
cccctgatatcggccacagggtctacccgtatgggcaaaatcgtagcccagaacgtagcg
gcccgcttaggcaaatcgctcttggaactgggtggcaacaacgccataatcgtcaccccc
gatgccgatattaagatgacggtaatcggcgcggtattcggtgcggtaggaacggcaggt
caacgctgtacctccaccagaaggctcatcattcacgaaagtatttacgaccaggtcaag
acggcccttgtagaagcctataaacaacttagaatcggcaacccattggacgaaaacaac
catgtaggcccactaatcgataccgatgcggtggcccattataaaaatgcccttgataaa
gtagttgaagaaggaggaaaaattattgtggatggaggtgttctcgaaggcgagggctac
gaaagtggctgctatgtaaaaccggccattgccgaggcgcaacccgattttaaaatcgta
caacacgaaacctttgccccggtactttaccttttgaaatattcgggaagcgttgaagac
gccatcgatattcaaaacaacgtggcccaaggcctgtcttcggccattatgaccaacaac
cttcgtgaagccgagtacttcttatcggttgcaggtagcgattgtggtattgccaatgta
aatataggtacttcaggtgctgaaattggaggtgcttttggaggggaaaaagaaaccggt
ggcggtcgcgaatcaggttccgatgcctggaaggtctatatgcgcaggcagaccaatacc
attaactatactaccgagcttcctttggcgcaaggcatcaaattcgatttatag

DBGET integrated database retrieval system