KEGG   Zobellia galactanivorans: ZOBELLIA_2113Help
Entry
ZOBELLIA_2113     CDS       T01586                                 

Gene name
ligC
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zga  Zobellia galactanivorans
Pathway
zga03030  DNA replication
zga03410  Base excision repair
zga03420  Nucleotide excision repair
zga03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ZOBELLIA_2113 (ligC)
   03410 Base excision repair
    ZOBELLIA_2113 (ligC)
   03420 Nucleotide excision repair
    ZOBELLIA_2113 (ligC)
   03430 Mismatch repair
    ZOBELLIA_2113 (ligC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zga03032]
    ZOBELLIA_2113 (ligC)
   03400 DNA repair and recombination proteins [BR:zga03400]
    ZOBELLIA_2113 (ligC)
Enzymes [BR:zga01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ZOBELLIA_2113 (ligC)
    6.5.1.6  DNA ligase (ATP or NAD+)
     ZOBELLIA_2113 (ligC)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ZOBELLIA_2113 (ligC)
DNA replication proteins [BR:zga03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ZOBELLIA_2113 (ligC)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ZOBELLIA_2113 (ligC)
DNA repair and recombination proteins [BR:zga03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ZOBELLIA_2113 (ligC)
   NER (nucleotide excision repair)
    Other NER factors
     ZOBELLIA_2113 (ligC)
   MMR (mismatch exicision repair)
    Other MMR factors
     ZOBELLIA_2113 (ligC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: CAZ96271
UniProt: G0L5G7
LinkDB All DBs
Position
complement(2470799..2472463)
Genome map
AA seq 554 aa AA seqDB search
MKPQTISEMDVPTSIASNELGMRGFAALIKTLDSTNKTNIKVQALADYFRVANDTDKVWT
IAILSHRRPPRPVNTTLLREWASELANIPLWLFEESYHIVGDLAETIALIVPSSKTSTEK
TLTQFLEEMIALKKKSDVDKKTYLFENWKVLDYYERFVFTKLITGGFRIGVSQKLMTRAL
AKATEIDEDILAYKLMGNWDPNKITFQELILEENESDYLSKPYPFYLAYAIENEPEDLGD
VTHWSAEHKWDGIRSQVILRNDELFVWSRGEELVTDKYPEFNLFIQKIPNGTVIDGEILP
YIDGQIGTFNDLQTRIGRKMISKALLKKVPVILKAYDILEWKGKDIRNQPFTERRAILEK
LFKEVNHTDLPFHLSETMHFNSWEEAAIERERSREMFSEGLMLKHKDSPYLVGRKKGDWW
KWKVDPLTIDAVLTYAMRGHGRRSNLFTDYTFALWNTNDEGEKELVTFAKAYSGLTDAEF
RKVDAWIKKNTLERFGPVRSVTPHHVFEIAFEGIALSKRHKSGVATRFPRILRWRKDKTI
HEANSLGDLKLMIP
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacaaacaatatcagaaatggatgtcccaacctccattgcatcaaatgaattg
ggcatgagaggattcgctgcactaataaaaacactggacagcaccaataaaactaatata
aaggttcaggctttagccgactattttcgggttgctaatgatacggataaggtatggacc
attgctattctatctcatcgtagaccacctagacccgttaacaccacactgctgcgcgaa
tgggcttctgaattggcgaatatccccctttggctttttgaagagagctatcacattgtg
ggcgatttggcggaaaccattgctctcattgtaccatctagcaaaacatccacagaaaaa
acactgacccaatttctagaggagatgattgcgttgaagaagaaatccgacgtcgacaaa
aaaacctacctctttgagaactggaaagtactcgattactacgaacgttttgtttttacc
aagttgattaccggagggttccgtattggtgtcagtcaaaaattaatgacccgagccttg
gccaaagcaacggaaatagatgaggatattttggcctataaacttatgggaaactgggac
ccaaacaaaatcacctttcaagaacttattttagaagaaaatgaaagcgactatctatcc
aaaccctatccgttttatctggcctacgccattgaaaatgaaccagaggatttaggcgat
gttacccattggtccgccgagcataagtgggatggtatccgttcacaggtaatccttaga
aatgatgagctattcgtctggagccgtggtgaagaattagtcaccgataagtacccggaa
ttcaacctatttattcaaaaaataccaaacggtactgtaattgatggagaaatattaccc
tatatagatgggcaaataggcacatttaatgatttacagacacgcataggtcgcaaaatg
atttccaaggctttactcaagaaagtacctgttattttaaaggcgtatgatattttagaa
tggaaaggaaaggatattcggaaccaaccttttaccgaacgcagggctatcttagaaaaa
ttattcaaggaggtaaaccatactgacttaccttttcacctttcagaaaccatgcacttt
aattcttgggaagaggcagccatagaaagggagcgttcccgtgaaatgttcagtgaagga
ctcatgttaaaacacaaagattctccttatttagtaggtcggaaaaaaggcgattggtgg
aaatggaaagtagacccattaactattgatgccgtactcacttacgctatgcgaggtcat
ggtagacgcagtaatttgtttacagattatacctttgcactttggaacaccaacgatgaa
ggcgaaaaagaactggttacttttgccaaagcctattccggtcttaccgatgccgagttt
agaaaggtagatgcttggattaagaaaaacaccttggaacgttttggaccagtgcgctcg
gttactccacatcatgtatttgaaattgcctttgaaggcatagccttatcaaagcgccat
aaaagtggggttgccaccaggtttccgagaatattgaggtggagaaaagataaaactatt
cacgaagccaattccttaggggatttaaagttgatgattccttaa

DBGET integrated database retrieval system