KEGG   Zobellia galactanivorans: ZOBELLIA_2326Help
Entry
ZOBELLIA_2326     CDS       T01586                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
zga  Zobellia galactanivorans
Pathway
zga00020  Citrate cycle (TCA cycle)
zga00310  Lysine degradation
zga00380  Tryptophan metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
zga01200  Carbon metabolism
Module
zga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZOBELLIA_2326 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    ZOBELLIA_2326 (sucA)
   00380 Tryptophan metabolism
    ZOBELLIA_2326 (sucA)
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ZOBELLIA_2326 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N HTH_40
Motif
Other DBs
NCBI-ProteinID: CAZ96481
UniProt: G0LBV5
LinkDB All DBs
Position
2728813..2731626
Genome map
AA seq 937 aa AA seqDB search
MDKYSFLNTAHTSFFADLYDKYLKNPDSVEPSWRAFFQGFDFGTETALDELDVESLMTAK
AGENGVAQQMPESLQKEFQVIRLIDGYRSRGHLFTKTNPVRERRQYEPSLDLENFGLSQA
DLDTVFSAGEIIGIGANSLREIIEHLKRIYCDAIGVEYMYIRKPERVEWIQNWLNVNDNH
PKFNAEHKRRILKKLNQAVSFESFLHTKYVGQKRFSLEGNESLIPALDAVVERAAELGVE
QFVMGMAHRGRLNVLTNIFGKAAKDIFSEFDGKDYEQEIFDGDVKYHLGWTSERKTDNGN
RIKMNIAPNPSHLETVGAVVEGITRAKQDAHFPDDFSKVLPIVVHGDAAIAGQGLVYEVV
QMANLDGYKTNGTIHIVVNNQIGFTTNYLDARSSTYCTDVGKVTLCPVLHVNSDDAEAVV
HASLFALEYRMRFNRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHQNPRDIYAERL
LKEGVIEADFVKGLEEEYKASLEEELEDSRKEDKTEITPFMADEWKGFANVREWEMMERV
DTTFDKKELTKIAKVLTELPSDKKFLRKVEKLVRDRKKMFFETDRLDWAMGELLAYGTLL
QEGYAVRMSGQDVERGTFSHRHAVMKVEESEEEVMLLNHIGEKQAKFQIYNSLLSEYGVV
GFDYGYAMASPNTLTIWEAQFGDFSNGAQIMIDQYISAAEDKWKLQNGLVMLLPHGYEGQ
GAEHSSARMERYLQLCARDNMYIADVSTPAQMFHILRRQMKVNFRKPLIVFTPKSLLRHP
KAVSTVDELASGYFQEVIDDATANVDKVKTLVFCTGKFYYDLLAAKEEQGRDDVALVRVE
QLFPLPSEKMKEVIAKYTKADDLVWAQEEPRNMGAWSHMMMHFSDSDKFRVASRRFYASP
AAGSAVRSKMRHQQVIDYVFDKSKNNMSKPMPKPSKG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatattcctttctaaataccgcgcacacctctttttttgcggatttatacgat
aaatacctcaagaaccccgatagcgtagagccaagttggcgcgccttctttcaaggtttt
gattttggaaccgaaacagctcttgatgagttggatgtggaaagtctaatgaccgcgaaa
gcgggagagaacggtgtggcgcaacaaatgccggagtccttgcaaaaggagtttcaagtg
atccgcctgatagacggttatcgaagcagggggcatttgtttaccaaaacgaacccggtt
cgcgagcgaagacaatatgagccgagccttgatctcgagaatttcggactctcacaggcc
gatttggatacggtcttcagcgcaggtgaaatcattggcatcggtgcgaacagcttgagg
gagattattgagcacctgaagcgtatttattgtgatgccataggggttgaatatatgtat
attcgaaaacctgagcgcgtcgaatggatccagaactggctcaatgttaacgataaccat
ccgaaattcaatgcggagcacaagcgtcgcatcttaaagaaattaaaccaagcggtctct
ttcgaaagctttttgcataccaagtacgttggacaaaaacgcttttcattggaagggaac
gaatcgttaataccggcccttgatgccgtggtggagcgggccgccgaattgggtgtagag
cagtttgttatgggtatggcccacagaggtcgacttaacgtgcttaccaatattttcgga
aaggccgccaaggatatttttagcgaatttgatggcaaggattacgagcaggaaatcttt
gacggtgatgtaaaatatcatttagggtggacgtcggaacgcaagaccgataacggtaat
cgaataaaaatgaatattgcgcccaatccatcgcatttggaaaccgtgggtgcggtcgtc
gagggtataacacgggccaagcaagatgcccatttccctgacgatttttcaaaagtactt
cctattgtagtccacggtgatgcggctattgcgggtcaaggcttggtgtacgaagtagtg
caaatggccaatcttgatggttataaaaccaatggtaccatacatatcgtggtcaataac
caaatcggttttacgaccaattaccttgatgcacgtagttctacctattgtactgacgtg
ggtaaggtgaccctgtgtcctgtgttgcacgtcaattccgatgatgccgaagctgtggta
catgcgtctttattcgctttggaataccgtatgcgtttcaatagggatgtatttatcgat
ttattaggatatagaaaatatgggcataacgaaggtgatgagcctcgttttacccaaccc
aaattatacaaggccattgccaagcatcaaaacccgcgtgatatttatgcggaaagattg
cttaaggaaggggttattgaggccgattttgtcaaaggtcttgaagaagagtacaaagct
tccttggaagaggaacttgaagattcgcgtaaagaggataaaacggagattaccccgttt
atggccgatgaatggaaaggctttgccaatgttcgggagtgggagatgatggagcgcgtc
gatacgactttcgataaaaaggaactgaccaaaattgcaaaggtgctcactgagcttcct
tccgataagaagttcttgcgaaaggttgaaaaattggtgcgcgaccgtaaaaaaatgttc
ttcgaaaccgataggttagactgggcaatgggcgaattgttggcctatggtaccttgttg
caagaaggctatgcggttcgtatgtcaggtcaagatgtggagcgaggtaccttttcgcac
agacatgccgtaatgaaggttgaagagagtgaggaggaagtaatgctgttgaaccatatc
ggtgagaagcaagctaaattccaaatctacaactccttattgtcggaatacggtgtagtt
ggttttgattacggatatgccatggcgagcccgaatacgttgaccatttgggaggcgcag
tttggtgattttagcaacggtgcccaaatcatgatcgaccaatacatttcggcggccgaa
gacaagtggaagttgcagaacggattggtgatgttgcttccccatgggtatgaggggcag
ggagcggagcattcttccgcccgtatggagcgatatttacagctttgtgcccgtgataac
atgtatatagccgatgtttctaccccggcccaaatgttccatatcttaagaaggcaaatg
aaggtcaattttagaaaacctttgattgtctttacgcccaaaagtctgttgcgtcaccca
aaggccgtgtctacggtagatgaattggcttcgggttattttcaggaagtgatcgatgat
gctacggccaacgtagataaggtaaagaccttggtgttctgtaccggtaagttttattat
gacttgcttgcggccaaggaagagcaaggaagggatgatgtggccttggttcgtgtggaa
cagttgttccccttgccatcggagaaaatgaaagaggtgatagcgaaatatacgaaggcc
gatgatttggtctgggcacaagaagagcctcgaaacatgggggcctggagtcacatgatg
atgcattttagcgattctgataaattcagggtggcttctagaagattctatgcttcgccg
gccgcgggtagtgccgttcgttccaaaatgagacatcaacaagtgatagattatgtgttc
gataagagcaagaataatatgtcaaaaccaatgcccaagccaagcaagggttaa

DBGET integrated database retrieval system