KEGG   Zobellia galactanivorans: ZOBELLIA_3533Help
Entry
ZOBELLIA_3533     CDS       T01586                                 

Gene name
bgaC
Definition
(GenBank) Beta-galactosidase, family GH2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
zga  Zobellia galactanivorans
Pathway
zga00052  Galactose metabolism
zga00511  Other glycan degradation
zga00600  Sphingolipid metabolism
zga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ZOBELLIA_3533 (bgaC)
  Lipid metabolism
   00600 Sphingolipid metabolism
    ZOBELLIA_3533 (bgaC)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ZOBELLIA_3533 (bgaC)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ZOBELLIA_3533 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: CAZ97671
UniProt: G0L8L9
LinkDB All DBs
Position
4080886..4083378
Genome map
AA seq 830 aa AA seqDB search
MNLLKKALYTLGFYMFALSFYNCENSNELEVKPREKIKFDFDWKFKKGDFPGADKAVFND
ADWETLDLPHDWSMAGPFKKDNPSGNVGAYAPGGIGWYRKKFSLDKTDAGSKINIEFGGV
YMNSEVWINGNYLGKRPYGYISFNYDLTPYLNFDADNVLSVRVDNSKEPSARWFTGSGIY
RHVWLVKTNALHISRYGVYATTPEVSKEKATVEVKTKVENESNGPEKFVVVNTIYDAGGK
VLAQHESTSELLGNKEEEILQQIQVGTPVLWSPENPYLYTLRTEVKRNDEVVDQVETNLG
IRSFEFTAENGFSLNGKNIKLKGVNNHSDLGALGAAINDKVLERRLKILKDMGCNAIRTA
HNPPSATLLDLCDKMGFMVMDEAFDEWLESWPFGNKKKEGKAKYGYHLYFEEWAEKDLTE
LIKRDRNHPSIILWSVGNEIPDACFEEGTERLKVLMDIVREHDATRPITCGITHMHLANE
SGFASQLDVTGYNGGGGSAFMYEKDRETYPERKFLATEVPHTFQTRGVYQSQSWYRGKNP
LGGIMKVPDLSNEEVFGEVSKYYSSSYDNSMVRISARDSWRRTRDFPYMAGEFRWTGFDY
LGESMFGWPAKLFNFGVIDMCGFPKDTYYFYQSQWTEAPMVHILPHWNWEGKEGVEIPVV
AYSNCDSVELFLNGKSLGTKEMGDAMDLMWKVPYTPGTLMAKGIKDGKVVCEKVIVTADK
PAKIELLADTDTVNANGQDVVHVEVNIRDKDNNFVPNASNEIKFTLTGEATILAVDNGDP
KSEESFIGDTRKAFNGKCIIIVKTTKKQGEFTIKAESEGLKMATVSAKSI
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgaatttactcaaaaaggcactatacacccttggtttttacatgttcgcactctctttc
tacaattgtgaaaattctaatgaactagaggtaaagccacgcgaaaaaataaaattcgac
tttgattggaagtttaaaaaaggggattttcccggagcggacaaagcggtctttaatgat
gccgattgggagaccctagacctaccacatgattggagtatggccgggcctttcaaaaag
gataatccctcagggaacgttggggcctatgcgccaggaggaattggttggtacagaaag
aaattcagtttagataagaccgatgccggatcaaaaataaacattgagttcggaggggtc
tatatgaacagtgaagtatggatcaacgggaattatttgggtaaacgcccgtatggctat
atcagctttaattacgacttgaccccttacttgaattttgatgcggataatgtactgtcc
gtaagggtcgacaactccaaagagcccagtgcaaggtggtttacgggttctggtatttac
agacatgtttggctggtaaagaccaatgcactgcatataagccgttatggggtttacgct
acaactcctgaagtttcaaaggaaaaggctacggtagaggtaaaaacgaaagtggagaac
gaatctaatggcccggagaaatttgtggtcgttaataccatttatgacgctggtggcaag
gtattggcccagcatgaatctacttccgaattattgggaaataaagaagaggaaatcctt
cagcaaatacaggtagggactccggtattatggtcgcctgaaaacccgtatttatatact
ctaagaacagaagttaaacggaatgatgaggtagtagaccaagtagaaaccaatttagga
attcgcagttttgagtttaccgcagaaaatggtttttcattaaacggcaagaacatcaaa
ctaaagggggtgaataaccacagtgaccttggtgcgctgggtgccgctataaatgacaaa
gttcttgagcgtagactgaaaatactcaaagacatgggctgtaatgccatccgtacggca
cataatccgccaagtgccactttgttggacctttgtgataagatgggctttatggttatg
gacgaggcttttgacgagtggttggagtcatggcccttcggaaataaaaagaaagaggga
aaagccaaatacggctaccatttgtattttgaggaatgggccgaaaaagatttgacggaa
ttgatcaaaagagatcgtaaccacccatccattatattgtggagtgtggggaatgaaatt
cccgatgcttgttttgaagagggaacggaacgattgaaagttcttatggatatagttcgt
gaacatgatgctacacggccaataacctgtggtattacccatatgcacttggcaaatgaa
agcggattcgctagccaattggatgttaccgggtataacggtggcggtggttctgcattt
atgtacgaaaaagatcgagaaacctatcctgagcgaaaatttctggccacggaagtaccc
catacgtttcaaacccgtggggtctatcaaagccaatcgtggtacaggggtaaaaatccc
ttgggaggaattatgaaggtgcctgatctttcaaatgaagaggtgttcggtgaggtaagt
aaatattacagttcttcttatgacaattctatggttcgcatctcggcaagggattcgtgg
agacggacaagggactttccttatatggctggggagttcaggtggaccggctttgactat
ttgggggaatcgatgttcggttggccggccaagctatttaattttggcgtgatagatatg
tgcggctttccgaaagacacctactatttttatcagagtcagtggacggaagcgcctatg
gtgcacattcttcctcattggaattgggaaggaaaggaaggtgtggaaataccggtcgtg
gcttactccaattgcgatagtgtagagctgttcttgaacgggaaatcgctggggacaaaa
gaaatgggtgatgccatggatttgatgtggaaagtaccatatacccccggaaccctaatg
gctaaaggtattaaagatggcaaggtggtttgcgaaaaggtgattgttaccgcggacaaa
cctgcgaaaattgaactattggcagataccgataccgtaaatgcaaacgggcaggatgtg
gttcacgtagaggtgaatatacgtgacaaagacaacaattttgtgccaaacgcctcgaac
gaaattaagtttaccctaacaggggaagctactatcctagcggtagataatggcgatccc
aaaagtgaagaaagctttattggcgatacaagaaaggcttttaacggcaaatgcatcatt
attgtcaaaaccactaagaagcagggggagtttacgatcaaggcggaaagtgaaggtcta
aaaatggccacggtttcggcaaaatcaatttaa

DBGET integrated database retrieval system