KEGG   Zobellia galactanivorans: ZOBELLIA_369Help
Entry
ZOBELLIA_369      CDS       T01586                                 

Gene name
susA
Definition
(GenBank) Alpha-amylase, family GH13
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
zga  Zobellia galactanivorans
Pathway
zga00500  Starch and sucrose metabolism
zga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZOBELLIA_369 (susA)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ZOBELLIA_369 (susA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase zf-C2H2_12
Motif
Other DBs
NCBI-ProteinID: CAZ94442
UniProt: G0L998
LinkDB All DBs
Position
complement(500010..501443)
Genome map
AA seq 477 aa AA seqDB search
MKKIYRFFCFGLAIMASCSSDDDQSVVADTNDNTQKEIISPIELSDYDNGSGVMMQTFYW
DVEPRGEWWTNLSGKIDDWAESGVDRLWLPVATKGASGGYSMGYDPSDYFDFGEFDQHGT
VETRFGSRQELETLIEKAHGKGLEVIADIVINHNSGGGEEYNPYRDKNTYTLFDELHGNA
SGMFNRNFENFYPNSTSNYDDGSLFYAEQNLDHNQEYVQNWLWKSENSVAKYYKNVMGFD
GWRFDYVLGYEPWVVKAWLDEVGGFSVSELWDGNADVLSQYVDQTGSGVFDFATFYKLEE
AMDRFDDLTVLEGKMLWKTHPDKSVTFAANHDTEKDENEDNRIADENKLKAYAYILTHPG
YPTIFYSDYENEAFKEPLKQLVQIHNSLAIGDAEVLYVDNDEYIMKRAGTDDNPGLILYI
NTSGNTKKRTIKSAWNNSYLMDYTKNVHGSITSDENGEALIEAPANGYSIWSIAKVN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatctacagatttttttgtttcggactggccataatggcctcttgttcgagt
gatgatgaccaatcggtagttgccgataccaacgacaatacccaaaaggaaattataagt
ccaattgaactatctgattacgataatggaagcggggttatgatgcaaaccttttattgg
gatgttgagccaaggggggagtggtggacaaacctctctggaaagatagacgactgggcc
gaaagtggggtagacaggttgtggttgcccgtagcgaccaagggggcatcgggaggttac
tccatggggtatgacccatccgattattttgattttggcgaatttgaccaacacggaaca
gtggaaacccgtttcggtagccggcaagagttggaaacattgattgaaaaagcccatggg
aagggcttggaagttatcgccgatattgttattaaccacaattcgggagggggagaggaa
tataacccgtatagggacaaaaatacctatactttgttcgatgaattgcacggtaatgcc
tctggaatgttcaataggaatttcgaaaatttttacccgaacagtacgagtaattatgac
gatggaagtttgttctacgccgagcagaatctagatcacaaccaagaatatgttcaaaat
tggctatggaaatcggagaattcggtagccaaatattataagaacgtaatggggtttgat
ggatggcgcttcgattatgttttaggatatgaaccttgggtggtcaaggcatggttagat
gaagtagggggattttcggtaagtgaactctgggatggaaatgccgatgtgctttctcaa
tatgtcgatcagacgggtagtggagtctttgattttgctaccttctataaattggaggaa
gctatggaccgttttgacgatcttacggttttggaaggtaaaatgttgtggaagacccat
cctgataaatccgttacctttgccgccaatcacgataccgaaaaagatgaaaacgaagac
aatcggattgccgatgagaacaaattaaaggcctatgcctatatattgacacatccgggc
tatccgaccattttctattccgattatgaaaatgaagcgtttaaagaaccgttgaaacag
ctcgtacaaattcataatagcttggctataggtgatgccgaagtgctttatgttgataat
gatgagtacatcatgaaacgagcgggtaccgatgataatccagggttgatactatatatc
aatacttcggggaatactaaaaaacgaacgataaagtcggcatggaacaatagctattta
atggattacaccaaaaatgtccatggctcgattacgagtgatgaaaatggagaggccctt
attgaggcacctgccaacggctacagtatttggtctattgccaaagtaaattaa

DBGET integrated database retrieval system