KEGG   Zobellia galactanivorans: ZOBELLIA_4265
Entry
ZOBELLIA_4265     CDS       T01586                                 

Gene name
cgiA1
Definition
(GenBank) Iota-carrageenase, family GH82
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
zga  Zobellia galactanivorans
Brite
KEGG Orthology (KO) [BR:zga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ZOBELLIA_4265 (cgiA1)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     ZOBELLIA_4265 (cgiA1)
SSDB
Motif
Pfam: Pectate_lyase_3
Other DBs
NCBI-ProteinID: CAZ98400
UniProt: Q9F284
LinkDB
Position
complement(4980692..4982167)
AA seq 491 aa
MKLQFKPVYLASIAIMAIGCTKEVTENDTSEISEVPTELRAAASSFYTPPGQNVRANKKN
LVTDYGVNHNDQNDDSSKLNLAIKDLSDTGGILTLPKGKYYLTKIRMRSNVHLEIEKGTV
IYPTKGLTPAKNHRIFDFASKTEEKIENASIVGKGGKFIVDLRGNSSKNQIVADVGNVTN
FKISNFTIKDEKTIFASILVSFTDKAGNAWPHKGIIENIDQANAHTGYGLIQAYAADNIL
FNNLSCTGGVTLRLETDNLAMKTAKKGGVRDIFATKIKNTNGLTPVMFSPHFMENGKVTI
DDVTAIGCAYAVRVEHGFIEIFDKGNRASADAFKNYIEGILGAGSVEVVYKRNNGRTWAA
RIANDFNEAAYNHSNPAVSGIKPGKFATSKVTNVKATYKGTGAKLKQAFLSYLPCSERSK
VCRPGPDGFEYNGPSLGVTIDNTKRDNSLGNYNVNVSTSSVQGFPNNYVLNVKYNTPKVC
NQNLGSITSCN
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaaattacaatttaaacctgtttatttagcgtcaattgccataatggcaataggatgc
accaaagaagtgacggaaaacgatacctccgaaatttcggaagttccaactgaattgagg
gccgcggcttcttcattttataccccaccgggtcagaatgtacgggccaataaaaaaaac
ctggtcacggattacggtgttaaccacaatgatcagaacgatgatagtagcaaattaaac
ctggctatcaaagatttatcggataccggtggtatactgacccttcctaagggaaagtac
tatttgaccaaaattagaatgcgctctaatgtacatcttgaaatagaaaagggaacggta
atctatccgaccaaggggttgactcctgcgaagaatcacagaatttttgattttgccagt
aaaacagaggaaaaaatagaaaacgccagtatagtgggtaaaggaggtaagtttatagta
gacctaagaggcaacagttctaaaaaccaaattgtagccgatgttggtaacgtaaccaac
tttaaaatatcgaattttacgatcaaggatgaaaaaaccatctttgcttcgatattggta
agctttacggataaggcaggcaatgcttggccacataaaggtattattgagaatatagac
caggcgaatgcccatacgggatatggcctcatacaggcgtacgcggcagataacattctg
ttcaacaatctaagttgtacgggcggggtaaccttgcgtttagaaaccgacaacctcgct
atgaaaaccgctaaaaaagggggggtaagggatatttttgccacaaagatcaagaatacc
aatggcttgaccccggtaatgttctctccccattttatggaaaacggtaaagtgaccata
gatgatgtaaccgccatcggttgtgcatatgccgtacgtgtagagcacggttttatagag
attttcgataaggggaatagggcaagtgccgacgctttcaagaactatattgaaggtatt
ctaggagctggctcggtagaagtcgtgtacaaacgtaataacggaagaacatgggcggca
cgtatcgcaaacgactttaacgaagcggcgtataaccactccaatcctgccgttagcgga
atcaaaccagggaaattcgccacatctaaggtaaccaatgttaaggcaacctataagggt
actggcgccaaactcaagcaggcattcttatcctatttaccctgttcggaacgttctaag
gtttgtcggccaggtccagatgggttcgagtataacggaccctccttgggagttaccatc
gataacacgaaaagggacaacagccttggcaattataacgtcaatgtaagcacctccagt
gttcagggctttcccaataattacgttttaaacgtaaagtataatacccctaaagtatgt
aaccaaaatctaggtagtattacttcgtgtaactga

DBGET integrated database retrieval system