KEGG   Ziziphus jujuba (Chinese jujube): 107405734Help
Entry
107405734         CDS       T04794                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00010  Glycolysis / Gluconeogenesis
zju00053  Ascorbate and aldarate metabolism
zju00071  Fatty acid degradation
zju00280  Valine, leucine and isoleucine degradation
zju00310  Lysine degradation
zju00330  Arginine and proline metabolism
zju00340  Histidine metabolism
zju00380  Tryptophan metabolism
zju00410  beta-Alanine metabolism
zju00561  Glycerolipid metabolism
zju00620  Pyruvate metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107405734
   00053 Ascorbate and aldarate metabolism
    107405734
   00620 Pyruvate metabolism
    107405734
  Lipid metabolism
   00071 Fatty acid degradation
    107405734
   00561 Glycerolipid metabolism
    107405734
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107405734
   00310 Lysine degradation
    107405734
   00330 Arginine and proline metabolism
    107405734
   00340 Histidine metabolism
    107405734
   00380 Tryptophan metabolism
    107405734
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107405734
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107405734
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107405734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 107405734
NCBI-ProteinID: XP_015868310
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MAARRISSLLSRAVYASSSIGPASLLLSRGRGSVRGNGIKKFSTAAATEELIIPPVQISY
TKHLINGQFVDAASGKTFPAHDPRSGEVIAHVAEGDAEDINRAVSAARKAFDEGPWPKMS
PYERSRILLRFADLVEKHSDELAALETWNNGKPYEQAAKSELPLFVRLFHYYAGWADKIH
GLTVPADGDHHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKTAEQTPLT
ALYVAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAARS
NLKPVTLELGGKSPFIVCEDGDIDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLE
KSKKRALRRVVGDPFKKGVEQGPQIDEEQFQKVLRYIRSGIDSNATLECGGGRLGNKGYF
VEPTVFSDVKDDMLIAQDEIFGPVQSILKFKDIDEVIKRANATRYGLAAGVFTKNIDTAN
TLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcggagaatatcgtcgttgctttcacgtgccgtttatgcttcttcttctatt
gggccagcttctctgcttctttctcgaggaagaggttcagtgagaggaaatggtatcaag
aagttcagcactgctgcagcaactgaagaattaatcattccaccagttcagataagctat
acgaagcatcttatcaatggacaatttgtagatgctgcatcaggaaaaacatttccagct
catgaccctcgttcaggagaagtgattgctcatgttgctgaaggtgatgcagaagatata
aaccgtgcagtttctgctgcacgtaaggcattcgatgaaggaccatggccaaagatgtca
ccatatgaaaggtcacggatactgttgcgctttgctgatttagttgagaaacatagtgat
gaacttgcagctctagaaacatggaacaatgggaagccttatgaacaggccgccaaatct
gaattaccattgtttgttcgtcttttccattactatgccggatgggcggacaagatccat
ggactaactgttccagctgatggagatcatcatgtgcaaacgttgcacgaaccgatcggt
gttgcagggcagattattccatggaacttccctcttatcatgtttgcttggaaagttggt
ccagcactagcatgtggtaatactattgtcctaaagactgctgagcaaacacctctgact
gctctctatgtggcaaaacttttccatgaggctggtcttccccctggtgttttaaatgta
gtttctggctatggaccaactgccggtgcagctcttgccagtcatatggatgttgacaag
ctagctttcacaggctcaactgatactggaaaaattgttcttgaactggctgcaagaagc
aatctgaaaccagtaacgttggagcttggagggaaatcaccattcatagtctgtgaggat
ggtgacattgataaggctgttgaacttgcacattttgctttgttctttaatcagggacag
tgttgctgtgctggctctcgtacatttgtacatgaacgcgtatatgatgaattcctagag
aaatcaaagaaacgtgctttaagacgcgttgttggtgatcccttcaagaagggtgttgaa
caagggcctcagatcgatgaagagcagtttcagaaggtcctcaggtacataagatctgga
attgatagcaatgctacccttgagtgtggaggaggaagactgggaaacaaaggctacttt
gtcgagcctaccgttttctcagatgttaaggatgacatgttgatagcacaggatgagatc
tttggaccggtacaatcaatcttgaaattcaaggatattgatgaagtaataaaaagggca
aatgcaaccagatatggattagcagctggggttttcaccaagaacatcgacactgccaac
accctgacacgtgcattgagagcggggactgtatgggtcaattgcttcgatgtattcgat
gctgcaattcctttcggtgggtataagatgagtgggattggaagggaaaagggaatctac
agcctcaacaattacttgcaggtgaaggctgttgttactcctctgaagaatccagcatgg
ttgtga

DBGET integrated database retrieval system