KEGG   Ziziphus jujuba (Chinese jujube): 107407854Help
Entry
107407854         CDS       T04794                                 

Definition
(RefSeq) hexokinase-2, chloroplastic-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00010  Glycolysis / Gluconeogenesis
zju00051  Fructose and mannose metabolism
zju00052  Galactose metabolism
zju00500  Starch and sucrose metabolism
zju00520  Amino sugar and nucleotide sugar metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
zju01200  Carbon metabolism
Module
zju_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zju_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107407854
   00051 Fructose and mannose metabolism
    107407854
   00052 Galactose metabolism
    107407854
   00500 Starch and sucrose metabolism
    107407854
   00520 Amino sugar and nucleotide sugar metabolism
    107407854
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107407854
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zju04131]
    107407854
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107407854
Membrane trafficking [BR:zju04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107407854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107407854
NCBI-ProteinID: XP_015870665
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MSLAATCPAVGSFYLSRSPRGTPRFKMAVRSGALSVAPILTNLQKDCATPLPVLRHVADA
MEADMLAGLAVDGGSDLKMILSYVDSLPSGNEKGLFYALDLGGTNFRVLRVQLGGKEERV
IATEFEQVSIPQDLMFGTSEKLFDFIASGLAEFALKEGGKFHLPPGRLREIGFTFSFPVK
QTSIDSGILIKWTKGFAVSGTAGRDVVACLNEAMKRQGVNMRVSALVNDAVGTLAGARYW
DNDIMVAVILGTGTNACYVERLDAIPKLQGQISSNGKTIINTEWGAFSTGLPLTVYDREM
DDASINPGEQIFEKTISGMYLGEIVRRVLLKMAKDGDLFGSSFPEKLATPFVLSTPDICA
MQQDNSSDLQAVGSILYDVAGVEANLRARKIVVEVCDTIVKRGGRLAGAGIVGILQKMEE
DSKGLIFGKRTVVAMDGGLYENYPQYRGYLQDAVTELLGSDISKNVVIEHSKDGSGIGAA
LLAAANSKYEHDF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttgctgccacatgtccagccgttggatcattttacctgtcgcgatcccccagg
ggcacgcctcgcttcaaaatggccgtccgatctggtgccctttccgtggctccgatcttg
accaacttacagaaggactgcgccactcctttgccagtgctccgccacgtggccgatgcc
atggaggctgatatgctagctgggctagccgtcgacggtggaagcgacctcaagatgatc
ctcagctatgttgatagtctccctagcgggaacgagaaaggtttgttttatgcattggat
ctcggaggcacaaacttcagggtgctgagagtgcaattaggtgggaaagaagagcgcgtc
atcgccactgaattcgagcaagtatctatccctcaagatctcatgtttggcacctctgag
aaacttttcgatttcattgcttctggactggccgaatttgctctaaaggagggtgggaaa
tttcacctgccacctggtagattaagggagattggattcacattttcatttcctgtgaaa
cagacttccatcgactctggaatcctgataaagtggaccaaaggttttgcagtctctgga
acggcaggaagagatgttgtcgcttgtctgaacgaagctatgaaaaggcaaggagtaaat
atgcgagtgtctgccctggttaatgatgctgtgggaacactagctggggcaagatattgg
gacaatgatatcatggttgctgtcattttgggtaccggaaccaatgcttgctatgtggaa
cgtttggatgctattccaaagctacagggtcagatttcctccaatggaaaaacgattata
aatactgagtggggagcattctcaactggtcttcctctaaccgtgtatgatagagaaatg
gatgacgccagtatcaaccctggtgagcagatttttgagaaaacaatatcaggaatgtat
ctcggtgaaattgtacgaagagtgctgctgaagatggccaaagacggtgatttgtttggt
tcatctttcccagagaaattggcaacaccatttgtactcagcaccccggatatttgtgcc
atgcagcaggataactccagtgatcttcaagcagttggatcaatcctttatgatgtagct
ggggtggaggcaaacttaagggcaaggaagattgtcgtggaggtatgcgacaccattgtg
aaacgaggtgggcggctagcaggtgctggaattgtggggattctgcaaaagatggaagag
gattcaaaaggactcatctttggaaagaggacagtggtggctatggatggagggttgtat
gaaaattaccctcagtacagaggatacttacaagatgcggtaacagagcttctaggatca
gatatctcaaagaacgtggttatagagcattcaaaagatggatcaggtataggagctgct
ctattggctgctgcaaactccaagtatgagcatgacttttaa

DBGET integrated database retrieval system