KEGG   Ziziphus jujuba (Chinese jujube): 107410655Help
Entry
107410655         CDS       T04794                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:zju00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107410655
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107410655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107410655
NCBI-ProteinID: XP_015873592
LinkDB All DBs
Position
2
AA seq 219 aa AA seqDB search
MQAALAAMVAQTIVFSSSPSYTLFSPLSNPNPSLHSSFHGVSFKLPRQSHSLSLAAAPKP
LAVVAATKKAVAVLAGTSNVEGVVTLTQDDNGPTTVNVRVTGLTPGPHGFHLHEYGDTTN
GCISTGAHFNPNNLTHGAPEDEIRHAGDLGNIVANANGVAEATIVDKQIPLGGPNSIVGR
AFVVHELEDDLGKGGHELSLSTGNAGGRLACGVVGLTPV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgctttggctgccatggtagcccagaccatcgtcttctcttcttccccatcc
tataccctcttctcccctctttccaatcctaacccatctctccattcctccttccatggc
gtttccttcaagctccctcgtcaatcccactccctctccctcgccgcagcccctaagcct
ctcgccgtcgtcgccgccaccaagaaagccgttgctgtcctcgccggcacctccaatgtc
gaaggtgtcgtcacgctgacccaagacgacaatggtcccacaactgtgaatgttcgtgtt
actggacttactccagggcctcatgggtttcacttacatgagtacggtgacacaacaaat
ggttgcatttctacaggagcacatttcaatcctaataatctgacacatggtgctcctgag
gacgaaatccgtcatgcgggtgacctgggaaacatagttgccaatgccaacggcgtggca
gaggcgacaatcgtggataaacagataccacttggtggtcctaattcaatagttggaaga
gcttttgtggttcatgaacttgaggatgatcttggaaagggtgggcatgaacttagcctg
agcactggcaacgctggaggaaggctggcatgtggtgttgtgggtctgactccagtttaa

DBGET integrated database retrieval system