KEGG   Ziziphus jujuba (Chinese jujube): 107417169Help
Entry
107417169         CDS       T04794                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like isoform X1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00620  Pyruvate metabolism
zju00710  Carbon fixation in photosynthetic organisms
zju01100  Metabolic pathways
zju01200  Carbon metabolism
Module
zju_M00168  CAM (Crassulacean acid metabolism), dark
zju_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
zju_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
zju_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    107417169
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107417169
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107417169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107417169
NCBI-ProteinID: XP_015881239
LinkDB All DBs
Position
4
AA seq 965 aa AA seqDB search
MAARNLEKMASIDAQLRLLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEGLRETVQDC
YELSAEYEGKQNPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADEASATTESDIEETIKRLVVQLKKSPQEVFDELKNQTVDLVLTAHPTQSVRRS
LLQKHARIRNCLTQLYAKDITRDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNVGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRARADELHRSSKKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARQLLANGTSDIPEETTFTNVEQFLEPLELCYRSLCFC
GDQPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLGIGSYREWSEERR
QEWLLAELRGKRPLFGPDLPKTEEIADVLDTFHVISELPSDNFGAYIISMATAPSDVLAV
ELLQRECRVKEPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELVKVAKKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIATK
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHMIEKDVKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSKELWSFGERLRTNYEQTKNLLLQVAGHKDLLEGDPYLRQRLRLRDSYITTLNVCQV
YTLKRIRDPNYNVKVRPHLSKEYMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtaatttggagaagatggcttcaattgatgctcagttgagattgctggca
ccagcaaaagtttctgaggatgacaaactgattgaatatgatgctttgttgttggatcga
tttcttgatatacttcaggatttacacggagagggtctcagagaaacggttcaagactgt
tatgagctttctgcggagtacgaggggaagcaaaatccaaagaagttggaggagcttgga
aatgtgctcacaagtttggatccaggggactcaattgttgttgccaaatcattttcccac
atgcttaatctggccaatttggctgaggaagttcaaattgcttatcggagaaggataaag
ttgaagaagggagattttgctgatgaagcttcagctacaactgaatcagacattgaagag
accataaagaggcttgtggtgcaattgaagaagtcgcctcaggaagtttttgatgaattg
aagaaccagactgtagatttggtcttaactgcacatcctactcagtctgttcgcagatct
ctgcttcaaaagcatgcaaggataagaaattgtttaactcaattgtatgctaaagacata
actcgtgacgataagcaggaacttgatgaggctttgcaaagagagattcaagctgcattt
cgtacagatgaaatccgaaggactcctcctaccccacaagatgagatgcgggcaggaatg
agctactttcatgagacaatttggaaaggtgtaccaaaattcttacgccgtgttgacaca
gctctaaagaatgtgggaatcaatgaacgtgttccttacaatgccccacttattcaattc
tcttcttggatgggtggtgatcgtgatggaaaccccagggttactccagaagttacacga
gatgtgtgcttgcttgctagaatgatggctgccaacttgtacttttcccagatagaggat
ctgatgtttgagttgtctatgtggcgctgcaatgatgagctacgtgctcgtgctgatgag
cttcatagatcttcaaagaaagatgcaaaacactacatagaattttggaagcagattcct
ccaaatgagccttatcgtgttatccttggtgatgtaagggacaagctttacaacacacgt
gaacgtgctcgtcaattattagccaatggaacctctgacattccagaggagacaactttt
acaaatgttgagcagtttttggagcctctcgaactgtgttacaggtcactctgcttttgt
ggtgatcaaccaatagctgatggaagccttcttgatttcttacgacaagtctctactttt
ggcctttcacttgtgagacttgatatacgacaagaatcagacaggcacactgatgttata
gatgctatcactaagcacctgggtattggatcttatcgagaatggtctgaggaacgcagg
caagaatggcttttggctgagctcaggggcaagcgccctctatttggccctgaccttccc
aaaactgaagaaattgctgatgttttggatacattccatgtcatttcagaacttccctcg
gataattttggtgcctatattatttctatggcaacagctccatctgatgtacttgctgtt
gagcttttacagcgtgaatgtcgtgtaaaggagccactaagggtagtcccattgtttgaa
aagcttgctgatcttgaggctgctcctgctgctgtggctcgactcttctctatagattgg
tacaaaaaccggatcaatggaaagcaagaagttatgatagggtactcagattcaggaaag
gatgctggacgtctctctgctgcttggcaattatataaggctcaagaagagctcgtaaag
gtggcgaagaaatttggtgttaagcttacaatgtttcatgggcgaggagggactgtcgga
agaggaggaggacccactcatcttgccatattgtcccagccacctgacacaattcatgga
tcacttcgtgtgacagttcaaggtgaagttattgaacagtcattcggggaggagcattta
tgctttagaacactccagcgtttcacagcagctacacttgagcatggaatgcatccccct
gtctcaccaaagccagaatggcgtgctctaatggatgagatggcagttattgcaacaaag
gaatatcgttcaatagttttccaagagcctcgctttgttgaatatttccgccttgcaaca
cctgagttggagtatggtcgaatgaacattggcagtcgtccatcaaaacgcaagccaagt
ggaggcattgaatcactccgtgcaatcccatggatctttgcatggacccagacaaggttt
catttaccagtatggcttggctttggagcagcatttaagcacatgattgagaaggatgtg
aagaatcttcacatgcttcaagagatgtataatcagtggcctttctttagggtcacaatt
gatttagttgagatggttttcgccaagggagacccaggaattgctgctctgtatgacaag
ctcctagtctcaaaagagctatggtcatttggagagcgcctgagaaccaactatgagcaa
actaagaacctccttcttcaggttgctggacacaaagatcttctggaaggtgatccctat
ctgaggcagagacttcgacttcgtgattcatatatcaccacactcaatgtgtgccaagta
tatacactgaagcggatccgtgatcccaactataatgttaaggtaagaccgcacttgtcg
aaggaatacatggagtcaagcaagccagcagccgagcttgtgaagctgaacccaacaagt
gagtatgctcctggtctggaggacacacttattttgaccatgaagggtattgctgccggc
atgcagaacactggataa

DBGET integrated database retrieval system