KEGG   Ziziphus jujuba (Chinese jujube): 107418477Help
Entry
107418477         CDS       T04794                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00052  Galactose metabolism
zju00500  Starch and sucrose metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107418477
   00500 Starch and sucrose metabolism
    107418477
Enzymes [BR:zju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107418477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107418477
NCBI-ProteinID: XP_015882662
LinkDB All DBs
Position
1
AA seq 907 aa AA seqDB search
MKKRANLLEIPCFLVVLGFLFLGLLNGSNGQDPIGFGYSVRSVVSNDTGKFLTAKLELIN
GTNTFGPDVQSLTLTASYDTKDRLRIRITDAKTQRWEISHDIIPRPFHPTNPLNHDHLSP
PSENLSSPSENQIILSDPNSELVFTLHNTTPFSFTVSRNCSGDVLFDTSPNGSNPDTFFI
FKDQYIQLSSSLPDNNRSSLYGLVERTRSSFKLTLGQNFTLWNSDIPSARTDVNLYGSHP
FYLDVRSASGDGKAAAGTSHGVLLLNSDGMDIVYGGDRITYKVIGGVVDLYIFSGSTPEL
VTEQYTELIGRPAPIPYWAFGFHQCRWGYKDISDVEGVVANYSKAQIPLEVIWTDIDYMD
AYKDFTLDPINFPLDKMKGFTERIHQNGQKYVLILDPGISVNKTYETYLRGIKADAFIKR
DGIPYLGSVWPGSVYFPDFLNPAGGTFWGNEIKIFRDILPFDGVWLDMNEIINFITSPPT
PSSKLDDPPYKINNAAIQRGINNNTVPATALHFGNITEYNAHNLYGLLEAKATNAALVNV
IGKRPFILSRSTFVGSGKYTAHWTGDNAATWDDLAYTIPSILNFGLFGIPMVGADICGFF
GDTTEELCRRWIQLGAFYPFARDHSAKSTIREELYLWDSVAASARKVLGLRYWLLPLFYT
LNYEAHKKGTPIARPLFFSFPQDTKTYDINSQFLIGRGILVSPVLKSGAVSVDAYFPAGN
WFDLFNLSRSVSAQSGQYFKLDAPPDHINVYVREGNILALQREALTTKAARRTPFQLLVV
SSSSTNSTGEVFLDDGEEVEMGEAGGKWSLVSFSSSVQGDKVVVESNVVNAEFALSQKWI
IDRITAIGLTKAKRLKGYELYTMSGRSFAKHYGIKTSFDSSDQFSKVEMSGLSLLIGEPF
KIVLNLG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagagcaaatcttcttgaaattccttgttttcttgttgttttggggttttta
tttcttggtttattgaatggatcgaatggacaagatcctattggatttggatactctgtt
cgatccgttgtttctaatgacaccggcaagttcttgactgctaaacttgaactcatcaat
ggtaccaacacttttggtccggatgtacaatcactcacgcttactgctagctatgacaca
aaggaccgtctgaggatccgaatcacagacgccaaaacccaaagatgggaaatctcccac
gatatcatcccccgaccattccatcccaccaaccccctaaaccacgaccacctctctccg
ccgtcggaaaacctctcctcaccgtcggaaaaccagatcatcctttccgacccaaattcc
gaactcgtctttaccctccacaacaccactccattcagcttcaccgtctcccgcaattgc
tccggcgacgtcctcttcgacacctcccccaacggttcgaacccggacaccttcttcatc
ttcaaagaccagtacatccaactctcctcctctctcccagacaacaacaggtcctctctg
tacggcctcgttgagcgaaccaggagctccttcaagctcacccttggacagaattttacc
ctctggaactctgacatccccagcgcaagaaccgatgtcaatctttatgggtcccaccct
ttctatctggatgtcagatcggcctccggtgatgggaaagccgctgccggaaccagtcat
ggtgttttgctgctcaacagcgatgggatggatattgtatatggtggtgataggattacg
tataaggtgattggtggagttgttgatctgtatatcttttctgggtcgacgccagaattg
gtgactgagcagtacacagagcttattggccgccctgcccctattccatactgggctttt
ggatttcatcaatgccgatggggttacaaggacatttctgatgtggagggcgtggttgct
aattattccaaagctcaaattcctcttgaagttatttggacagatattgactacatggat
gcatataaggatttcactcttgatcccattaattttccactggataagatgaagggtttt
actgaaagaattcaccaaaacggacagaaatatgtgctcatcttagatcctggtatcagt
gtgaacaaaacatatgaaacctacttaagagggataaaagccgatgccttcataaaacgt
gatggtatcccctacttggggagtgtttggcctggatcagtctacttccctgatttctta
aatccggctggtggaactttttggggtaatgagatcaagatatttcgagatattcttccc
tttgatggtgtctggcttgacatgaatgagataatcaatttcataacatcccctccgaca
ccatcttctaaacttgatgaccctccatacaaaatcaataatgctgcaatccagcgagga
attaataataatacagtaccagctacagctttgcacttcggcaacattacagagtacaat
gcccataacctttatggtctattggaagctaaagccacaaatgcagccttagtcaatgtt
attggtaagaggcctttcatactttcaagatcaacttttgttggctctggtaagtacaca
gcacattggactggagacaatgctgccacttgggatgatttggcttataccattccatcc
attctaaacttcggattgtttggaattccaatggttggtgctgatatatgtggtttcttc
ggagacactactgaggagctctgtagacgttggattcagttaggtgctttttatcccttt
gcaagagaccactctgctaagtctacaatccgtgaagagctctatctttgggattcagtt
gctgcatcagccaggaaggttcttggtctccgctactggctgcttcccttattctacaca
cttaattatgaggcacacaaaaaggggacccctattgcacgaccccttttcttctccttt
cctcaagacaccaaaacttatgacatcaattcacaatttttaattggtagaggtatattg
gtgtcacctgtattgaagtcaggagcagtttctgttgatgcatacttcccagcaggaaac
tggtttgacctctttaatctctcccgttcagttagtgcacaatcaggacagtatttcaaa
cttgatgcacctcctgatcatataaacgtgtatgttcgagaaggaaatatcttggccctg
caaagagaagcattgacaacaaaagccgcacggagaacaccattccagctcttggttgtc
agcagtagcagcacaaacagcaccggagaagtttttctagatgatggggaggaggtggag
atgggagaagcgggagggaagtggagtctggtgagtttttcaagctcagttcaaggggac
aaagtggtggttgaatcaaatgttgtgaatgcagaatttgctttatctcagaagtggata
attgacagaattaccgctataggattgacaaaggctaagagactgaaaggttatgaatta
tatacaatgtcaggaaggagtttcgcgaaacattatggtattaaaactagctttgatagc
tctgatcagttcagcaaagtagagatgtcagggttgtcgttgcttataggagagccattc
aagatagtattgaatcttggctag

DBGET integrated database retrieval system