KEGG   Ziziphus jujuba (Chinese jujube): 107419053Help
Entry
107419053         CDS       T04794                                 

Definition
(RefSeq) histone deacetylase 5-like
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zju01009]
    107419053
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:zju03019]
    107419053
   04131 Membrane trafficking [BR:zju04131]
    107419053
   03036 Chromosome and associated proteins [BR:zju03036]
    107419053
Enzymes [BR:zju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107419053
Protein phosphatases and associated proteins [BR:zju01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107419053
Messenger RNA biogenesis [BR:zju03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107419053
Membrane trafficking [BR:zju04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107419053
Chromosome and associated proteins [BR:zju03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107419053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 107419053
NCBI-ProteinID: XP_015883261
LinkDB All DBs
Position
5
AA seq 991 aa AA seqDB search
MSYASPSSFSRVDQNPPEPSSVIEVTERVARGKSNSGVAIVRPPGHHAEQDEAMGFCLYN
NVAIAMSFLLNEKQPEFGINRILIIGWDVHHGNATQKMFWEDCRVLSFFVHRHEFWSFYP
ANNNDYYNMVGEGPGAGYIINVPWQNCQYGDADYLAVWDHILIPFAKEFDPDIIIISAGF
DAAIGDPLGGCHVIPYGYLVMLNKVHQELSPFWPDGSSSNFGTSLGMKLTCEATHKVPHK
AKSTHKGARRACPSMAHLRTHAQVRCFRQQRLLLMPCNSTCIALPCNTACALALVQAYPH
TSMPRHACAILHVDACFGADLLLDDQKANINPPLRAINIILRQEPQAFRESIDVVYFVLE
FSIFVGICLVAFEFFSWVFKWVLVDFSFLRCVLFDAKEAEDKSILAVHSVNHVNLIKDIS
SNQYSEKARARIASMYNSIYFNEGSSEAAYLAAGSVIEVTEKVAKGELNSGVAIVRPPGH
HAERDEAMGFCLFNNVAVATSYLFNEKPELGINRVLIVDWDVHHGNATQKMFWEDPRVLF
FSVHRHEFGSFYPATEDGYYTKVGKGPGAGYNINVPWENGLCGDADYLAVWDHILIPVAK
EFNPDIIIISAGFDAAIGDPLGGCRVTPYGYSVMLKKLLNFANGKIVLALEGGYNLESIA
NSMLACVKVLLEDNPIPGSSEAYPFESTWRVIQAVRQELSPLWPVLVDELPKKLISQTAP
TVPYYLSSSSDSDVEENKGPDAVSENLEDVLRGVIEPLSKLKVGEDKMASNSMTWRSELS
KIHIWYSSFGSNMWRPRFMCYIQGGQVEGLQRPLPGCMDKSPPKGTLWKILPYRLFFGRN
FSRSWGPGGVAFINPEVNIHEKTYMCLYRITLEQFNDVLLQENDPSVTLSSPLFDLTALN
SIMTGTSKSQEINMEKGWYRNVTYLGKAGDLPILTLTCRLSEVEGFRSGKIPLCPPGKSY
TNILLRGLVEGKQLSEEEAIAYIQEAATKPL
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatgcttctccttcaagcttcagccgggtcgaccagaacccacctgaaccgagc
tctgtaatagaggttactgaaagagttgctaggggaaaatcaaattctggtgtcgctatt
gttagacctccagggcatcatgctgaacaagatgaagcaatgggattttgtctatataac
aatgtggctattgcaatgagtttcctattaaatgaaaaacaaccagaatttggtatcaac
cggattttaatcattggttgggatgttcaccatgggaatgctactcaaaagatgttctgg
gaagattgtcgtgttttatccttctttgttcataggcatgagttttggagtttttatcct
gccaataacaatgattattacaatatggttggtgaaggtccgggtgcagggtatattata
aatgttccatggcagaattgtcagtatggggatgcagactatcttgcagtttgggaccac
attttaattccttttgccaaggaatttgatccagacattattataatctctgctggattt
gatgcagccattggtgatcccctaggaggttgtcatgtcataccatatggatacttagta
atgctgaacaaggttcaccaggaattgagtcctttttggcctgatggctcaagtagtaat
tttggaacaagtttgggcatgaagttgacatgtgaagccactcataaagtgccccataaa
gcaaaaagcactcataagggagctcgaagggcatgcccaagcatggcacatttgcgcacc
catgcccaagtgaggtgcttcaggcagcaacgcctgctcctcatgccatgcaacagcacc
tgcatagcacttccgtgcaacacagcgtgcgcccttgcccttgtccaggcctacccgcac
acatctatgccccggcatgcctgtgccatcctccatgttgatgcttgttttggagctgat
ctcctccttgatgatcaaaaggccaatattaacccacctttgagggctataaatatcatc
ttaaggcaagaaccccaggcctttcgggaaagtattgatgtggtttattttgttttagaa
ttttcaatttttgtgggtatttgtttggttgcatttgaatttttcagttgggttttcaaa
tgggttttggtggatttttcgtttctcaggtgtgtcctgtttgatgccaaagaagctgaa
gataaaagtattttggcagttcattccgtaaatcatgtgaacttgattaaggatataagc
tccaatcagtattccgaaaaagccagagccaggattgcgtctatgtacaattccatatat
ttcaatgaaggatcatctgaagctgcatatcttgcagcaggttctgtaatagaggtaacc
gaaaaggttgctaaaggtgaattaaattctggtgtcgctattgttaggcctccaggacat
catgctgaacgagatgaagcaatgggattttgtctattcaacaatgtggctgttgcaacc
agttacctgtttaatgaaaaaccagaattgggcattaaccgggttttaattgttgattgg
gatgttcaccatggaaatgctacacaaaagatgttttgggaagatcctcgtgttttattc
ttctctgttcataggcatgagtttgggagcttttatcctgctactgaagatggttactat
actaaggttggaaaaggaccgggtgcaggatataatataaatgttccatgggagaatggt
ctgtgtggggatgcagactatcttgcagtttgggaccacattttaattcctgttgccaag
gaatttaatccagacattattataatctctgctggatttgatgcagccattggtgatccc
cttggaggttgtcgtgttacaccatatggatactcagtaatgctgaagaagctgttgaat
tttgccaatggtaagattgtattggctttagaaggaggatacaatctcgagtccatagca
aattcaatgcttgcttgtgttaaagttctcctagaagacaatcctattcctggatcctct
gaggcctatccatttgagtcaacatggcgagtaatacaagcggttcgccaggaattgagt
cctttgtggcctgttcttgtagatgaactaccaaagaagttgatcagtcaaacagcacct
acagttccgtattatctgtcctcaagttctgattccgatgtggaggaaaacaaaggtcca
gatgctgtatctgaaaatcttgaagatgttcttcgtggtgttatagagcccctctcaaag
ttaaaagttggtgaagataaaatggcaagcaattccatgacctggagatcagagctttca
aagattcacatatggtatagcagttttggatcaaatatgtggagaccaagattcatgtgc
tatattcaaggtgggcaggtggaaggcttgcaaagaccattacctggctgcatggataaa
tctccaccgaaggggacactctggaagatattaccataccgcttgttctttggtcgaaac
ttttctcgttcatggggtcctggaggggtcgcttttattaatcctgaagtcaacatccat
gaaaaaacttacatgtgcctgtacagaattacgcttgagcagttcaatgatgttttgctg
caagaaaatgatcccagtgtcaccctcagttctcctttgtttgatttgactgctttgaac
tcgatcatgactggaacgtccaagtcgcaggagattaacatggagaagggctggtaccgt
aatgttacctacctgggaaaggctggtgatctccctatattgactttaacgtgtagactt
tcggaagttgagggcttcagatctggaaagattcccttgtgtcccccaggcaaaagttac
acaaatatcttacttagaggtctggtagaaggaaaacagctttctgaagaggaggcaatc
gcctatattcaagaagctgcaactaaaccattgtga

DBGET integrated database retrieval system