KEGG   Ziziphus jujuba (Chinese jujube): 107419654Help
Entry
107419654         CDS       T04794                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00250  Alanine, aspartate and glutamate metabolism
zju00410  beta-Alanine metabolism
zju00430  Taurine and hypotaurine metabolism
zju00650  Butanoate metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Module
zju_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107419654
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107419654
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107419654
   00430 Taurine and hypotaurine metabolism
    107419654
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107419654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6 YjeF_N
Motif
Other DBs
NCBI-GeneID: 107419654
NCBI-ProteinID: XP_015883907
LinkDB All DBs
Position
5
AA seq 501 aa AA seqDB search
MVLSKTIEDSGEHLHSTFASRYVRTPLPRFTMPEKPIPKEAAYQIINDELMLDGRPRLNL
ASFVTTWMEPECDKLIMESINKNYVDMDEYPVTTELQNRCVNMIAQLFNAPVGENEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKLEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPVKAVELVDENTICVAAILGSTLNGEFEDVKLLNELLTEKNKVMGFDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKEDLPDDL
IFHINYLGSDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCTENAKVLKEGLEK
TGRFNIISKDIGVPLVACSLKDSSKHTVFEVSESLRRFGWIVPAYTMPANAEHVAVLRVV
IREDFSRSLAERLVSDIERVLAEIDARPSQVSTISAHVTAADESQNREVKEKHVQKSETE
IQARVINYWKRLVDGKRTGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctcagcaagacgattgaagacagtggagagcacttgcactccactttcgcttcc
agatacgttcgtactcctctcccaaggttcacgatgccggagaagccgattccgaaagaa
gcggcgtaccagatcataaacgacgagctgatgctagacggcaggccgaggctgaatttg
gcttcgttcgtgacgacgtggatggagccggagtgcgataagctgatcatggagtcgatc
aacaagaactacgtcgacatggatgaataccccgtcaccaccgagcttcagaatcggtgt
gtgaatatgatagcccaactgttcaatgctccggttggagagaatgaagctgctgttggt
gtgggaactgttgggtcatcagaggcaataatgctggcaggtctagcttttaagagaaag
tggcagaataagagaaaattagagggtaaaccttatgataagccaaatatagtcactgga
gctaatgtgcaggtttgctgggagaagtttgcaaggtactttgaggttgagctgaaggag
gtaaagctttcagaagggtattatgtgatggatcctgtaaaagcagttgagttggtagat
gagaacaccatctgtgtagcagcgattctaggatcaacattgaatggagagtttgaggat
gtgaagctccttaatgaactccttaccgaaaagaataaggtgatgggattcgacactccc
attcatgttgatgctgccagtggaggatttatagctccattcctttatcctgatcttgag
tgggatttccgtttgcctctagtcaaaagcatcaatgtgagcggtcacaaatatggcctt
gtataccctggtgttgggtgggttgtttggaggagtaaagaggacttgccagacgatctt
atctttcatatcaattaccttgggtctgatcaacctactttcaccctcaacttctcaaaa
ggctccagtcaaataattgctcaatattatcaacttatccgactgggttttgagggttac
aagaatatcatgcaaaactgcacggagaatgcaaaagtattgaaagaaggcttagagaaa
acagggcggtttaacatcatctccaaggatattggggtacccttagtggcctgctcccta
aaagacagcagcaaacacactgtctttgaggtgtcggagagtttgagaaggtttggatgg
attgttcctgcctataccatgccagcaaatgccgaacacgttgctgtccttagggtggtg
attcgagaggatttcagcaggagcttggccgaaagacttgtctcggacattgagagagtt
ttggctgaaatagacgcacgtccaagccaggtctcaaccatatccgcccatgtaacagct
gctgatgaaagccaaaaccgtgaagtgaaggagaagcatgttcagaaaagtgaaaccgaa
attcaagcaagggtaatcaactattggaagcggcttgtcgatggaaagagaactggagtg
tgctag

DBGET integrated database retrieval system