KEGG   Ziziphus jujuba (Chinese jujube): 107424507Help
Entry
107424507         CDS       T04794                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107424507
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zju03036]
    107424507
Enzymes [BR:zju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107424507
Chromosome and associated proteins [BR:zju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107424507
   Polycomb group proteins
    PRC2-EZH2 complex
     107424507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR MPS2
Motif
Other DBs
NCBI-GeneID: 107424507
NCBI-ProteinID: XP_015889809
LinkDB All DBs
Position
8
AA seq 925 aa AA seqDB search
MASKASPSASASGSKSGEDLTMMGSQGTSPNLKEISSVIEFLKKQVASQRGVSIQKRMEE
NKQKLVGVTNYMYNLSMARRSTWINDTGKNVDLLIRRQKDAFDMHNGIDVNNGDKDTLDE
DGHASTAVLLGSNVAVKNAVRPIKLTEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYY
DQNGGEALICSDSEEEAMEDEEEKRDFVESEDYVLCMTIKEVGFSDTVLETLAQCFSRSP
CEVKARYEILNKEEKAVGDCKNGDNEDASQIGSSFLDKDLDAALDSFDNLFCRRCLVFDC
RLHGCSQDLVFPAEKQPSWSPPDDENISCGLHCYRSVLKSERTVGVSSPSNGDFEEKNVT
SCEGVQISLRKKPSGPSARKTVKSCQSESASSNAKNISESSDSENGHTQDDSHIHHPSPS
KTKLAGKCGIRKRNSKRVAERVLACMQKRQKKMVASDSDSIVNGGVPSDTKLRSNSCKEN
EDSSSSSHKNVKSPIGGRSRRKESTVKDSHIQVEVPDGSSNEMITDPPATSSDDNIRKEE
FVDENLCKQESGDDKSWKTIEKGLFEKGIEIFGRNSCLIARNLLSGLKTCWEVFQYMNHS
QFKMSCQPGDASNSLMEGYSKVDFNGSMGNNEARRRSRFLRRKGRVRRLKYTWKSAAYHS
IRKRITERKDQPCRQYNPCNCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS
QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL
GRSDISGWGAFLKNNVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLD
AYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAW
ARKPEASGSKKEDGGPSSGRAKKLA
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaggcttcgccttcagcgtcggccagtggatcgaagtccggcgaggatctt
acgatgatgggatcacaaggaacaagtccaaatcttaaggagatatcatcagttattgaa
tttctaaagaagcaagttgcttctcaacgtggtgtttccatacagaaaagaatggaagag
aacaagcagaaactagttggggttacaaactatatgtataatttgtcaatggcaagaaga
agcacctggattaatgatactggtaaaaatgtagatctgttgataaggaggcagaaagat
gcttttgatatgcacaatggtattgatgtaaataatggtgacaaagatacattggacgaa
gatggccatgcttctacagcagttcttctaggatctaatgttgcagtcaagaatgctgtt
cgtcctattaagctaacggaagttaaaagattacctccttataccacatggatatttttg
gacagaaatcagagaatgacggaggatcagtcagtagtaggtcgaagaagaatttattat
gatcaaaatggaggtgaagctctaatatgcagtgatagtgaggaagaagcaatggaagat
gaagaagaaaagagggattttgtggaatccgaagactatgtactttgcatgactatcaaa
gaagttggtttctctgatactgtgctggagacactggcacagtgtttttctagaagccca
tgcgaagtcaaggcaaggtatgaaattcttaataaggaagagaaggccgtgggggattgt
aagaatggggataatgaagacgcttcacaaattggaagttcttttcttgataaagatctt
gatgcagctttggattcttttgataaccttttttgtcgtcgatgccttgtgtttgactgc
agattacatggatgttcccaagatcttgtcttccctgctgagaagcaaccttcgtggagt
cctcctgatgatgaaaacatatcatgtggtctacattgctatcgatcagtgctaaagtca
gaaagaactgttggtgtgagctctcctagcaatggtgattttgaagaaaaaaatgttaca
tcatgtgaaggtgttcagatatcgttgagaaagaaaccttctggtccatctgcaagaaag
acggtcaagtcctgccaaagtgaaagtgcttcgtcaaatgcaaagaacatctcagaaagc
agcgactcagagaatggacatacacaggatgatagtcacatccatcacccatctccctca
aagactaagcttgcaggaaaatgtggaattcgtaaaaggaatagtaagcgagttgctgaa
cgtgttctagcttgcatgcagaaaaggcaaaagaaaatggtggcatctgattctgattct
attgtcaatggtggtgttcctagtgatacaaaacttagatctaattcatgcaaagaaaat
gaagacagtagctcttcttcacataagaatgtaaaatctcctattggtggaaggtctaga
aggaaggaatcaacagtcaaggacagtcacatccaggttgaggttcctgatggttcttca
aatgaaatgatcactgatccacctgccactagtagtgatgacaacataagaaaagaagag
tttgtggatgaaaacttatgtaaacaagaatctggtgatgataaatcttggaaaactatt
gagaaaggtctttttgagaaaggcattgagatttttggacgaaacagctgtctaattgca
aggaaccttttaagtggtttgaagacttgttgggaggtttttcagtacatgaatcactct
cagtttaagatgtcctgccaacctggcgatgcttcaaactcacttatggaaggctattct
aaggttgactttaacgggtctatgggtaataatgaagctagaagaagatcgagatttttg
cgcagaaagggtagagttcgtcgcttaaagtatacttggaagtctgctgcttaccattca
atcaggaaacgaattactgagagaaaagatcagccatgtaggcaatataatccatgtaat
tgccaaacagcttgtggaaagcagtgtgcttgtcttctaaatgggacttgctgtgaaaag
tactgtggttgtcccaagagttgcaagaatcgatttagaggctgtcattgtgctaaaagt
caatgtcgaagtcgtcagtgtccatgctttgctgcggacagagaatgcgatccagatgtt
tgtaggaattgttgggtcagttgtggtgatggtactcttggggttccaaaccaaagaggt
gacaattatgaatgtagaaatatgaagctacttctcaaacagcaacaaagggtgttgcta
ggaagatctgatatatctggctggggagctttcttaaagaataatgttggcaagcatgaa
tacctaggtgagtacactggggagttgatatcacatcgagaagcagataagcgtggaaag
atatatgaccgtgaaaattcatcatttcttttcaatttgaatgatcagtttgtccttgat
gcttatcggaagggtgataaattgaagtttgccaaccattctccagatccaaattgctat
gcaaaggtgataatggttgctggggatcatagagtgggcatatttgccaaggaacgaatc
agtgcaggcgaggaacttttctatgattatcgatatgaaccagacagagctcctgcttgg
gcgcggaaacctgaggcatctgggtcaaaaaaagaggacggtggtccatcaagtggtcgt
gctaagaagcttgcttaa

DBGET integrated database retrieval system