KEGG   Ziziphus jujuba (Chinese jujube): 107424596Help
Entry
107424596         CDS       T04794                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00020  Citrate cycle (TCA cycle)
zju00190  Oxidative phosphorylation
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
zju01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107424596
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107424596
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107424596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 107424596
NCBI-ProteinID: XP_015889929
LinkDB All DBs
Position
8
AA seq 633 aa AA seqDB search
MWRCVSKGLRLSSSKRSISNDSLRSQFSRLFSSESTAGRSSYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSDGVCQGVIALNTEDGTLHRFRAAST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDNPDAI
VPGLLAAGETACASVHGANRLGANSLLDIVVFGRACANRVAEIRRPGEKQKPLEKNAGEK
TIAWLDKLRNSNGSLPTAQIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFHDVRV
KDRSLIWNSDLIETIELENLLINACVTMHSAEARKESRGAHAREDFNKRDDENWMKHTLG
YWENENVRLEYRPVHMNTLDEEVESFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctaaaggacttcgtctatcttcttcaaagagatcgatttcgaat
gactctcttagatctcaattttctcgactattctcctccgaatcaactgcgggacggtcc
tcatacaccgtggttgaccatacatacgatgcagtggttgtaggagctggtggtgccgga
ctgagagcagccatagggctctcagagcatggattcaacactgcttgcattactaagctt
ttcccaactcgttcacacactgttgctgcccagggtggtataaatgctgcattaggaaat
atgagtgaagacgattggaggtggcacatgtatgatactgttaaaggaagtgattggcta
ggtgatcaggatgccatccaatatatgtgtagggaggctccaaaagctgtaattgagcta
gagaattatggattgccgttttctcgtactgaagatggtaaaatatatcagcgtgcattt
ggtggtcagagccttgacttcggaaaaggtgggcaggcataccgctgtgcatgtgctgct
gatagaacgggtcatgcactgttacatactctttatggccaggctatgaaacataataca
caattttttgtggaatattttgctctggatctgttgatggacagtgatggtgtctgccaa
ggagtaattgcattaaacacagaggatggaacattgcatcggttccgtgctgcctcaaca
attttggcaacagggggttatggcagggcatacttttctgcaacctcagctcatacctgc
actggagatggcaatgccatggttgcacgtgctgggatcccgcttgaggatttggagttt
gtgcagtttcaccccacaggtatatatggggctgggtgcctcatcactgaaggatctcgt
ggagaaggtggtattcttcggaatagtgaaggtgagcgatttatggaacgatatgcccct
acagcgaaggatcttgcttcaagagatgttgtttcaagatctatgactatggaaatccga
gagggtcgtggtgtaggacctttgaaggaccatatttatctccacttgaaccatttaccc
ccagaagtactgaaggagaggcttcctggtatctctgaaactgctgccatttttgctggt
gttgatgttaccaaggagcccattcctgtcttgccaactgtccactataatatgggtgga
attccaacaaatcaccatggagaggttgttactattaaaggtgataatccagatgcgata
gttcctgggctattggctgctggagagacagcctgtgcatcagttcatggcgccaataga
cttggtgcaaattccctcctcgacattgtagtatttggtcgagcttgtgctaatagagtt
gcggaaattcgtagaccaggggagaaacaaaaacctttggaaaagaatgctggtgagaag
accattgcgtggctggacaaactaaggaattcaaatggttcattacctactgcacaaatc
cggttgaatatgcaaagaataatgcaaaataatgctgctgtattccgcacacaagaaact
ttagaagaaggttgtcagttgattgacaaggcatgggagagttttcatgatgtcagagta
aaggatcgaagtttaatatggaactctgacttgatagagactattgaactggaaaacctt
ttgataaatgcctgtgtcaccatgcattctgctgaagccaggaaagaaagcagaggagca
catgctcgggaagatttcaataaaagagatgatgagaactggatgaaacatactttggga
tattgggagaatgagaacgttcggcttgaatacaggccagtccacatgaacacattagat
gaggaagtcgagagtttcccacctaaagctcgtgtgtattga

DBGET integrated database retrieval system