KEGG   Ziziphus jujuba (Chinese jujube): 107428628Help
Entry
107428628         CDS       T04794                                 

Definition
(RefSeq) spermidine synthase 2
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00270  Cysteine and methionine metabolism
zju00330  Arginine and proline metabolism
zju00410  beta-Alanine metabolism
zju00480  Glutathione metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107428628
   00330 Arginine and proline metabolism
    107428628
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107428628
   00480 Glutathione metabolism
    107428628
Enzymes [BR:zju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     107428628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_30 MTS Kelch_1 Methyltransf_24 Methyltransf_11 Methyltransf_4 DRE2_N
Motif
Other DBs
NCBI-GeneID: 107428628
NCBI-ProteinID: XP_015894683
LinkDB All DBs
Position
10
AA seq 333 aa AA seqDB search
MAQEIVAGDLPLKSQIFKEENGVSVAMDTEGKKEPESISTVIPGWFSEISPMWPGEAHSL
KVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPK
KVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVSKQYFPDVAIGYQDPRVKLHIGD
GVAFLKAVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVARALRPGGVVCTQAESIWLHM
HIIEDIVSNCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPSVDFKHPVNPIDSNDNN
ISKRPLKFYNSEIHTAAFCLPSFARKVIDAKAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaaattgttgctggtgatttgccattgaagagccaaatatttaaagaagaa
aatggggtctcggtggctatggatactgagggtaaaaaagaacccgagtctatctctact
gttatacccgggtggttctctgagattagcccaatgtggcctggagaggctcactccttg
aaagtagagaagattttgtttcaggggaagtctgactatcagaacgtgatggttttccag
tcatcaacgtatggaaaggttcttgttttggatggggtaattcagctcactgaaagggat
gaatgtgcatatcaagaaatgattactcaccttcccctgtgctcaattccaaatccaaag
aaggttttggtcattggtggaggagatggtggggttctacgggaagtttctcgccattcc
tctgttgagcagatagatatatgtgaaattgacaagatggtggtggaagtttctaagcag
tactttcctgatgtagcaattggatatcaggatccccgggtgaaacttcatattggtgat
ggagttgcgtttttgaaagctgtaccagaaggaacttatgatgcagttatcgtggattct
tctgatccaataggtcctgcacaagagctctttgagaaacccttctttgagtcagtagca
agggcccttcgtccaggtggggtggtgtgtactcaggcagagagtatatggcttcatatg
cacataattgaggacattgtgtcaaattgccgccaaatatttaaaggctcggttaactat
gcatggactacagtcccgacatacccaagtggggtaattggcttcatgctctgttctact
gagggcccctctgttgattttaagcaccctgtgaatccaattgattcaaatgacaacaac
atatcaaaaagacccttgaaattttataactctgagattcatacagctgctttctgcctg
ccatcttttgcacggaaggtgattgatgctaaggcaaaatga

DBGET integrated database retrieval system