KEGG   Ziziphus jujuba (Chinese jujube): 107429424Help
Entry
107429424         CDS       T04794                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00010  Glycolysis / Gluconeogenesis
zju00020  Citrate cycle (TCA cycle)
zju00620  Pyruvate metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
zju01200  Carbon metabolism
Module
zju_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107429424
   00020 Citrate cycle (TCA cycle)
    107429424
   00620 Pyruvate metabolism
    107429424
Enzymes [BR:zju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107429424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 107429424
NCBI-ProteinID: XP_015895590
LinkDB All DBs
Position
10
AA seq 480 aa AA seqDB search
MASPFLSKTATNISFSSSLSNPLPWRFSHPSSASFPAKPRRRISIVQAKIREIFMPALSS
TMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAA
IGLLADTEEEIAEAKAKAAKSGSSSPPPAAVAPSPPPPASNPAPAIAQPPPPAAAKAVPD
GPRKIVATPYAKKLAKQHKVDIGSVVGTGPSGRITPADVESTAGITSTKKSVTVEPATPA
AAAPKAATPAAAANLLPGSTIVPFTTMQAAVSKNMVESLSVPTFRVGYPVTTDALDSLYE
KVKPKGVTMTAILAKAAAMALAQHPVVNATCKDGKSFTYNSNINIAVAVAINGGLITPVL
QDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGA
IMAVGASKPTVIADADGFFSVKSKMLVNVTADHRIIYGADLAAFLQTFAKIVENPESLTL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccgtttctctccaagaccgccacaaacatttccttctcttcctctctttcc
aatccactcccatggaggttctctcacccttcctccgcctcatttcccgccaaacctcgc
cggaggatctcgatcgtccaggccaagatcagggagatcttcatgccggccctcagttca
actatgaccgaggggaaaattgtctcctgggtcaaatccgaaggagacgtactctccaaa
ggtgagagcgtcgtcgtcgtcgagtccgataaggccgacatggacgtcgagaccttctac
gacggaattctcgccgcgattgtcgtcggcgagggcgaaaccgctcctgtcggagctgcc
attggtttgttggctgataccgaagaggaaatcgccgaagccaaagctaaagccgctaaa
tccggctcttcttcgccgccgcctgctgctgttgcgccgtctcctccacctcccgcttcc
aatcccgctccggcaattgctcagcctccgcctccggccgctgctaaggcggttcccgat
ggaccgaggaagattgtggccacgccgtatgcgaagaagctagccaagcagcacaaggtg
gatattggatcggtggtgggcactggaccttctgggcggattactccggcggatgtggag
tccacagccggaatcacgtcgacgaagaagagtgtaaccgttgaacctgcaactccggcg
gctgcggctccaaaagctgccactccagcagctgcggctaatctccttccgggctctacc
attgtgccattcaccacaatgcaagcggcagtgtctaagaacatggtggaaagtctctcc
gtgccaacattccgcgtgggttatccggtgaccactgatgcactcgactcactctatgag
aaggttaaaccaaagggtgtgaccatgaccgcaatattggcaaaggctgctgctatggca
cttgctcagcacccagttgttaatgctacctgcaaagatgggaaaagctttacatataat
agtaacataaacattgcagttgcggtggctatcaatggcgggttgataacccctgttctt
caggatgcagataagttggatttatatctgttatcccaaaaatggaaagagctagtggag
aaagcccgttccaagcaacttcagcctcatgagtacaattcaggaactttcacattgtcc
aatttgggcatgtttggtgtggacaggtttgatgctattctcccaccaggccagggggct
atcatggctgttggagcgtcaaagccaactgtcatagctgatgcagatggattcttcagt
gtaaaaagtaaaatgttggtgaatgtgacagctgatcaccggattatatatggtgctgac
ttggctgccttcctccagacatttgcaaagatcgttgagaaccctgaaagcctcacattg
tag

DBGET integrated database retrieval system