KEGG   Ziziphus jujuba (Chinese jujube): 107431119Help
Entry
107431119         CDS       T04794                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zju01001]
    107431119
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107431119
Protein kinases [BR:zju01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107431119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo FTA2 Pkinase_C APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107431119
NCBI-ProteinID: XP_015897490
LinkDB All DBs
Position
11
AA seq 484 aa AA seqDB search
MVSSQLSGLTETQTCKPFQSQLLFPLSPTDAVVSDNLELDFSDVFGPVPVQAPVEVNFGD
SALSVSVEDANELVYDDPVVIHNRSHSLVGPSSFVSQSLKLSKLTIQETDDPEEMAICAE
MDTIVKLDDGAYEESLEDIDAVSMKIQSVGIEDFEVLKVVGQGAFAKVFQVRKKGTSEIY
AMKVMRKDKIMEKNHAGYMKAERDILTKIDHPFIVQLRYSFQTKYRLYLVLDFVNGGHLF
FQLYHHGLFREDLARIYAAEIVSAVSHLHASGIMHRDLKPENILLDADGHAMLTDFGLAK
RFEENTRSNSMCGTVEYMSPEIVLGKGHDKAADWWSVGVLLFEMLTGKPPFTGNREKIQQ
KIVKDKIKLPAYLSSEAHSLLKGLLQKDATKRLGSGKMGSEEIKRHKWFKPINWKKLEAR
QIQPSFRPEVAGKQCVANFEKHWTDMPVVDSPVASPNAFGNNPFTGFSYVRPPASFLQMD
GSIS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctctcagctttctggtttgactgagacccaaacgtgtaaaccatttcagtcc
caactgctttttcctctgagcccaacagatgctgtagtttcagataatcttgagctagat
ttctctgatgtatttggtcctgtaccagttcaggcccctgtagaagtgaattttggtgat
tcagcactttctgtctctgttgaagatgcaaatgagctcgtttatgacgatcctgtagta
attcacaaccgttcacattctttggttggcccctcatcttttgtaagccaatccttgaag
ctcagcaagctcaccatacaagagacagatgatccagaggaaatggcaatctgtgctgaa
atggataccattgtaaaacttgatgatggtgcctatgaggaatctcttgaagacattgat
gcagtttccatgaaaatccaatctgtaggcattgaggattttgaggttttgaaggttgtt
ggacagggtgcatttgcaaaagtatttcaggtgaggaaaaaggggacgtcagaaatttat
gcaatgaaggtcatgcggaaggacaagataatggagaagaatcatgctggatacatgaaa
gctgagagggatattttaactaaaatagatcaccccttcattgtccagcttagatactca
ttccagaccaaatatagactctatcttgtgctggattttgttaatgggggtcaccttttt
tttcagctctaccaccatggtctttttagagaggatctagcacgtatatatgcagctgag
attgtttcagcagtttcccaccttcatgcaagtggcataatgcatagagaccttaaacct
gaaaatatcttattggatgcagatggccacgccatgttgactgattttggtctcgcgaag
cgatttgaagagaatacgagatccaattccatgtgtggaactgttgaatacatgtcacct
gagatagttcttggaaagggccatgataaggctgcagactggtggagtgtgggagtccta
ttgtttgagatgcttactggaaagcctccttttactggaaaccgggagaaaattcagcag
aagatagtaaaggataagataaagttgccagcatatttgtcaagtgaagcacattctctg
ctgaaagggcttcttcaaaaagatgcaactaaacgcctaggctctggaaaaatgggaagt
gaggaaatcaagcgccacaaatggttcaagccaatcaattggaagaaattggaggctcgg
caaatccaaccaagtttccgtcctgaagtcgccgggaaacagtgtgttgctaactttgag
aagcactggactgacatgcctgtggttgattctcctgttgctagcccaaatgcttttgga
aacaaccccttcaccggattttcttatgtgaggcctccagcctcttttcttcagatggat
ggctccatctcctag

DBGET integrated database retrieval system