KEGG   Ziziphus jujuba (Chinese jujube): 107434847Help
Entry
107434847         CDS       T04794                                 

Definition
(RefSeq) thymidine kinase a-like isoform X2
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00240  Pyrimidine metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    107434847
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     107434847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 AAA_24 cobW AAA_22 AAA_30
Motif
Other DBs
NCBI-GeneID: 107434847
NCBI-ProteinID: XP_015901829
LinkDB All DBs
Position
Unknown
AA seq 297 aa AA seqDB search
MLSISISRMKTLISPIKLTTFSSSPHLPQKAPFALFSFACKSILQNPPSLFPKPSLFHIK
PTIYFTTPTSVVCPVQKRGLQMESESVPSSRASSSGEVHVIVGPMFAGKTTTLLRRIQSE
STSGRSVAIIKSNKDTRYGLDSIVTHDGVKLPCWPLANLSSFRQKFGPDAYDQLDVIGID
EAQFFEDLYDFCREAADHDGKTVIVAGLDGDYLRKSFGCVLDIIPLADSVTKLTARCELC
GKRAFFTLRKTQETQTELIGGADVYMPVCRQHYVSGQVVLEAARVVLESQVTCSSYS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccatttctatttcaagaatgaaaacccttatttccccaataaagttgacaact
ttctcttcctcccctcaccttccccagaaagcaccatttgcgctgttttcttttgcatgt
aaatccattctgcaaaacccaccatcccttttcccaaaacccagtctttttcacattaaa
cccaccatctatttcaccaccccaacttcagtcgtttgtccggttcagaaacgaggcctg
caaatggaatcggagtcggtgccgtcgtctcgggcgtcgtcttccggtgaggttcatgtg
attgttggccccatgttcgccggaaagaccaccacactcctccgccggattcaatctgag
agcaccagtggcagaagtgtagccataataaaatcaaacaaggatacaagatatggattg
gattcaattgtgacacatgacggggtgaaattgccatgttggccattggcaaatttgtca
tctttcagacagaaatttggtcctgatgcatatgatcagttagatgtgattggtattgat
gaagctcaattctttgaagacctatatgatttctgccgtgaagctgctgatcatgatggc
aaaacagttatagttgctggactggacggtgactatttgaggaaaagttttggttgtgtg
cttgatataatcccccttgctgattctgtaaccaagttaactgctagatgtgaactttgt
ggaaaacgtgctttcttcacattaagaaagacacaggaaacacagacagagctcattggc
ggggctgatgtctacatgcctgtctgtcggcagcactatgttagcgggcaagttgtccta
gaggctgcaagagttgtactggaatctcaagtcacttgcagctcctattcatag

DBGET integrated database retrieval system