KEGG   Ziziphus jujuba (Chinese jujube): 112491400Help
Entry
112491400         CDS       T04794                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju03030  DNA replication
zju03410  Base excision repair
zju03420  Nucleotide excision repair
zju03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    112491400
   03410 Base excision repair
    112491400
   03420 Nucleotide excision repair
    112491400
   03430 Mismatch repair
    112491400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zju03032]
    112491400
   03400 DNA repair and recombination proteins [BR:zju03400]
    112491400
Enzymes [BR:zju01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112491400
    6.5.1.6  DNA ligase (ATP or NAD+)
     112491400
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     112491400
DNA replication proteins [BR:zju03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    112491400
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     112491400
DNA repair and recombination proteins [BR:zju03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     112491400
   NER (nucleotide excision repair)
    Other NER factors
     112491400
   MMR (mismatch excision repair)
    Other MMR factors
     112491400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 112491400
NCBI-ProteinID: XP_024928754
LinkDB All DBs
Position
4
AA seq 425 aa AA seqDB search
MASSKALKLDSLNLFLIAQTSFFHQPPPPLSFSPFPTAKTRCAVDAFHYAGDHSVSYLLS
HFHSDHFTGLSPNWXLFCSQTTAKLLIKVLKVPSQFIVPLPLSEPVVIDGCEVVLIDANH
CPGSVQFLFEILGSNGKFKKYVHTGGFRFCDSMKSDPFLCKFMGSNAILLDTTYCNPKFV
FPSQDXSIDYIVSVIEKIGGEYDGSMRNVLFLVATYVVGKEKIWLEIARKCKRKVYVDAR
KMAILRTLGCGERGXFTEDECGSDVHVVGWNLLGETWPYFRPNFVKMKEIKGEKGYTKAV
GFVPTGWTYEVKCNKFSRRTKDSFEIHLVPYSEHSNYIELGEHVKFLKPKRVVPTVGLDV
EKLDSKHVDKTKKHFAGLVDEMANKQEFLKGFHRGCDGVGETVEKDSGSATSQGLCYYLH
YPFLL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaaaagccctaaagctcgattccttaaacctattcctcattgcccaaacc
tctttcttccaccaacccccacctccactctctttctctccatttcccaccgctaaaact
cgttgcgccgtcgatgctttccattatgccggcgaccactccgtctcttacttactctcc
cacttccactctgatcatttcactggtctctctccaaattggnntctcttttgctcccaa
accaccgctaagcttcttatcaaagtgcttaaggttccttctcagtttatagtgccattg
ccgctctccgaacccgtcgtgattgatgggtgtgaggttgtactgatcgacgccaatcat
tgccctggttctgttcaattccttttcgaaattttgggttcgaacggtaaattcaagaag
tatgttcatacgggtggttttcggttttgtgattccatgaaatctgacccttttttatgt
aaattcatgggtagtaatgcaattttattggacaccacttactgtaatccgaaatttgta
tttccctctcaagattagtcgatcgattatattgttagcgtcatagaaaaaataggaggt
gaatatgatggttcaatgaggaatgtgctgtttcttgtagctacttatgttgtagggaaa
gagaagatttggctagaaattgcaaggaagtgtaaacgaaaggtgtacgtggatgctaga
aaaatggctatcctgcgcactctggggtgtggagagagagggntgtttacagaggatgaa
tgtggaagtgatgtacatgttgttggttggaatttgttgggtgagacttggccatatttt
aggcctaattttgtgaaaatgaaggagattaagggtgagaaagggtacactaaggctgtg
ggatttgttccaactgggtggacatatgaagtgaagtgcaataagttttcaaggaggaca
aaggattcatttgagatccatcttgtaccatatagtgaacattctaattatattgagctt
ggggaacatgtcaagtttttgaaaccaaaacgtgttgttcctacagtgggcttggatgtg
gagaaacttgatagcaagcacgttgataaaacgaaaaagcattttgctgggctagttgat
gaaatggccaacaagcaagaattcttgaagggttttcatcgaggttgtgatggagtgggt
gagacggttgaaaaggattctggcagtgccacaagccagggtttgtgctattaccttcac
tatccatttctgctgtga

DBGET integrated database retrieval system