KEGG   Ziziphus jujuba (Chinese jujube): 27963855Help
Entry
27963855          CDS       T04794                                 

Gene name
rbcL, A9277_gp061
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00630  Glyoxylate and dicarboxylate metabolism
zju00710  Carbon fixation in photosynthetic organisms
zju01100  Metabolic pathways
zju01200  Carbon metabolism
Module
zju_M00165  Reductive pentose phosphate cycle (Calvin cycle)
zju_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
zju_M00532  Photorespiration
zju_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    27963855 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    27963855 (rbcL)
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     27963855 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 27963855
NCBI-ProteinID: YP_009256335
UniProt: A0A172QDF1
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTSYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSLPGVIPVASGGIHVWHMPALTEIFGDDAVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagccggtgttaaagattat
aaattgacttattacactcctgaatatgaaaccaaagatactgatatcttggcagcgttt
cgagtaactcctcaacctggagttccgcctgaggaagcaggggccgcggtagctgctgaa
tcttctactggtacatggacaactgtatggactgacgggcttaccagtcttgatcgttac
aaaggtcgatgctacggccttgagcccgttgctggagaagaaaatcaatatattgcttat
gtagcttaccccttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtttttgggttcaaggccctgcgcgctctacgtttggaggatttgcgaatc
cctacttcttatactaaaactttccaaggaccgcctcatggcatccaggttgaaagagat
aaattgaacaagtatggtcgccccctattgggatgtactattaaacctaaattggggtta
tctgctaagaattacggtagagcagtttatgaatgtcttcgcggtggacttgattttacc
aaagatgatgagaacgtgaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagccctttataaagcacaggctgaaacaggtgaaatcaaagggcattacttg
aatgctactgcaggtacatgcgaagacatgatgaaaagggctgtatttgccagagaattg
ggagttcctattgtaatgcacgattacttaacagggggattcactgcaaatactaccttg
gctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcactttcgtgtactagctaaagcgttacgtctg
tctggtggagatcatattcacgctggtactgtagtaggtaaacttgaaggggaaagagac
atcactttaggctttgttgatttactacgcgatgattttattgaaaaagatcgaagccgc
ggtatttatttcacgcaagattgggtctctctaccaggtgttatccctgtggcttcaggg
ggtattcatgtttggcatatgcccgctctgaccgagatctttggagatgatgccgtacta
cagttcggcggaggaactttaggacacccttggggaaatgcgcccggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgag
ggtaatgaaattatccgtgaggctagtaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaggagatcaaatttgaattcgaagcaatggatactttgtaa

DBGET integrated database retrieval system