KEGG   Zea mays (maize): 100170246Help
Entry
100170246         CDS       T01088                                 

Gene name
hex2
Definition
(RefSeq) hexokinase 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00051  Fructose and mannose metabolism
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma00520  Amino sugar and nucleotide sugar metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Module
zma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100170246 (hex2)
   00051 Fructose and mannose metabolism
    100170246 (hex2)
   00052 Galactose metabolism
    100170246 (hex2)
   00500 Starch and sucrose metabolism
    100170246 (hex2)
   00520 Amino sugar and nucleotide sugar metabolism
    100170246 (hex2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100170246 (hex2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zma04131]
    100170246 (hex2)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100170246 (hex2)
Membrane trafficking [BR:zma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100170246 (hex2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 ROK NES_C_h
Motif
Other DBs
NCBI-GeneID: 100170246
NCBI-ProteinID: NP_001123599
UniProt: B3GQB5
LinkDB All DBs
Position
6
AA seq 507 aa AA seqDB search
MVKAVVVGAAVVACAAVGVAAVLVHRRRRRDAALLGSAEAERRRRAAAVIEEVERSLATP
TALLRGIADAMVAEMERGLRGDIHAQLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLR
VQLGGREKRVVKQQYEEVSIPPHLMVGTSMELFDFIAAALAKFVGTEGEDFQLPEGRQRE
LGFTFSFPVNQTSISSGTLIKWTKGFSINGTVGEDVVSELSRAMERQGLDMKATALVNDT
VGTLAGGRYMDTDVVAAVILGTGTNAAYVEHANAIPKWTGLLPKSGKMVINTEWGSFKSN
KLPLSEYDKAMDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPTKLEQ
PFILRTPDMSAMHHDSSHDLKTLGSKLKDIVGVADTSLEVRYITRHICDLVAERGARLAA
AGIYSILKKIGRDKVPSSGSKMPRTVIALDGGLYEHYKKFSSCVEATLTDLLGEEASSSV
VAKLANDGSGIGAALLAASHSQYGASD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccgtggtggtgggcgcggcggtcgtggcgtgcgcggcggtgggggtggcg
gcggtgctggtgcaccgccggcgcaggcgcgacgccgcgctcctggggtccgcggaggcg
gagaggaggcggcgcgcggccgccgtgatcgaggaggtggagcgcagcctcgccacgccc
acggcgctgctgcggggcatcgcggacgccatggtcgccgagatggagcgcggcctgcgc
ggggacatccacgcgcagctcaagatgctcattagctacgtcgacaacctccccaccgga
gatgaacatgggctgttttatgcactggatcttggagggaccaacttccgtgtgctgcga
gtccaactaggaggaagggagaaacgtgttgtcaaacaacagtacgaggaggtttccatt
ccaccacatttgatggtcgggacttccatggaactatttgatttcattgctgctgcattg
gctaaatttgtcggtactgaaggtgaagatttccaactcccagagggtaggcagagagaa
cttggtttcactttttccttcccggtgaaccaaacatcaatatcatcaggaacactcatc
aagtggacaaagggcttttccatcaatggcacggttggtgaagatgttgtttctgagttg
agcagggccatggagaggcagggactagatatgaaagctacggcattagtcaatgataca
gtgggcacattggctggtgggagatatatggataccgatgtagttgcagctgtaatattg
ggcactggtacaaatgcagcatatgtggagcatgcaaatgcaattcctaaatggactggg
ttactgcctaaatctggaaagatggtaattaatacagagtgggggagcttcaaatccaac
aaacttcctctttcagaatatgacaaagccatggactttgaaagtttgaaccctggagag
cagatatacgaaaaaatgatttctggcatgtatctgggagagattgttcgaagaatttta
ctcaagttggcacatgacgcttctctatttggagatgttgttccaactaagctggagcag
ccatttatattgaggacgccagatatgtcagccatgcatcatgactcttcgcatgacctc
aaaactcttggatctaaactgaaggatatagttggggtcgcagatacttccctggaagta
agatacattactcgtcacatctgcgaccttgtcgcagagcgtggagcacgcttggctgcc
gcaggtatatatagcatcctgaagaagataggccgggacaaagtaccaagcagtggcagt
aaaatgccaaggactgtaattgccttggatggtgggctctatgagcattacaagaagttc
agcagctgcgtcgaagcaactcttacagacttgctcggcgaagaggcctcttcctccgtg
gttgccaagctggccaacgatggctctggcattggagctgctctccttgcagcctcacac
tctcagtatggcgcgagtgactag

DBGET integrated database retrieval system