KEGG   Zea mays (maize): 100191549Help
Entry
100191549         CDS       T01088                                 

Gene name
gpm277
Definition
(RefSeq) uncharacterized LOC100191549
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
zma  Zea mays (maize)
Pathway
zma00250  Alanine, aspartate and glutamate metabolism
zma00410  beta-Alanine metabolism
zma00430  Taurine and hypotaurine metabolism
zma00650  Butanoate metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Module
zma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100191549 (gpm277)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100191549 (gpm277)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100191549 (gpm277)
   00430 Taurine and hypotaurine metabolism
    100191549 (gpm277)
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100191549 (gpm277)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 100191549
NCBI-ProteinID: NP_001130451
UniProt: B4F972
LinkDB All DBs
Position
1
AA seq 493 aa AA seqDB search
MVLSHGVGGSDESVHSTFASRYVRTSLPRYRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIQASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDAETAVG
VGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPQKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTKKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRTKVDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENATVLKQGLEK
TGKFNIVSKDNGVPLVAFSLKDSSRHSEFEISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDIEKVLHELDALPARVPSGDLAALAAAESSEREMEKQRQVISLWK
RAVLAKKKTNGVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtcacacggcgtcggtggctccgatgagtccgtccactcgacgttcgcgtcc
cgctacgtccgcacctcccttcctaggtaccggatgccggagcagtcgatccccaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccgcggctgaacctg
gcgtccttcgtcaccacgtggatggagcccgagtgcgacaagctcatccaggcctccgtc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagctgcagaaccggtgc
gtgaacatgatcgcgcatctcttcaatgctcctctcggggacgctgaaacggctgttgga
gtgggcaccgtcggctcgtccgaggccatcatgctggctgggctggcgttcaagaggcgt
tggcagaacaagatgaaggcggccggcaagccctgcgacaagccaaacattgtcaccggc
gccaacgtccaagtttgctgggagaagttcgcgcgctacttcgaggtcgagctgaaggaa
gtgaagctgagcgacggctactacgtcatggacccgcagaaggcagtggacatggtggac
gagaacaccatctgtgtcgcggccatcctcggttccacgctgaacggcgagttcgaggac
gtgaagctgctcaacgacctgctcaccaagaagaacgcggagacaggctgggacacgccg
atccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggaactggag
tgggacttccgactgccgctcgtgaagagcatcaacgtcagtggacacaagtatggtctg
gtctacgccggcatcgggtggtgcatctggaggaccaaggtggacctgccggaggagctc
atcttccacatcaactacctcggcgccgaccagcccaccttcaccctcaacttctccaaa
ggttccagccaggttattgcacagtactaccagctgatccgccttggctttgaaggttac
aagaacatcatggagaactgccaggagaacgcgacggttctgaagcaaggtctggagaag
acggggaagttcaacatcgtgtccaaggacaacggcgtgccgctggtggccttctccctc
aaggacagcagccggcacagcgagttcgagatctccgacttcctgcgccgcttcgggtgg
atcgtgccggcctacacgatgccccccgacgcgcagcacgtgaccgtgctccgcgtggtc
atccgcgaggacttcagccgcaccctcgcggagcgcctggtgctcgacatcgagaaggtt
ctgcacgagctggacgcgctgcccgcccgtgtccccagcggcgacctagccgcgctcgcc
gcggccgagtccagcgagagggagatggagaagcagcgccaggtgatctcgctctggaag
agggccgtcctcgccaagaagaagaccaacggcgtctgctaa

DBGET integrated database retrieval system