KEGG   Zea mays (maize): 100193519Help
Entry
100193519         CDS       T01088                                 

Gene name
gpm519
Definition
(RefSeq) Enoyl-[acyl-carrier-protein] reductase [NADH] chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
zma  Zea mays (maize)
Pathway
zma00061  Fatty acid biosynthesis
zma00780  Biotin metabolism
zma01100  Metabolic pathways
zma01212  Fatty acid metabolism
Module
zma_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100193519 (gpm519)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    100193519 (gpm519)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    100193519 (gpm519)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zma01004]
    100193519 (gpm519)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     100193519 (gpm519)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     100193519 (gpm519)
Lipid biosynthesis proteins [BR:zma01004]
 Fatty acid synthase
  Component type
   100193519 (gpm519)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 100193519
NCBI-ProteinID: NP_001132103
UniProt: B4FFA7
LinkDB All DBs
Position
4
AA seq 369 aa AA seqDB search
MTASAAAGVQMVAARPCISASPGILTARVSRTDCMLSTTATFPKISCSWPLRFKRNDVVV
RAISEECGPQGLPIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEILVGTWVPALNIFE
TSLRRGKFDESRKLPDGSLMDIVKVYPLDAVYDSPDDVPEDVKSNKRYAGASNWTVKEVV
ESVRNDFGSIDILVHSLANGPEVTKPLLETSRRGYLAAISASSYSYVSLLQHFLPIMNPG
GASISLTYIASERAIPGYGGGMSSAKAALESDTRVLAFEAGRKGKIRVNTISAGPLGSRA
AKAIGFIEKMIEYSYVNAPLQKELLADEVGNTAAFLVSSLASAITGSTVYVDNGLNTMGL
AIDSPTITS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttctgcagctgctggtgtgcagatggtggctgcacgcccttgcatttcggcc
tcgccaggaattcttaccgcacgggtttctaggactgattgcatgctcagtaccactgct
acattccccaaaatcagctgctcctggcctctaaggtttaagcgcaatgatgttgttgta
agagcaatatcggaagagtgtggcccgcaggggcttcccattgatctcagaggtaaaagg
gcattcattgctggagttgctgatgataatggctatggatgggcaattgcgaaggcactt
gctgcggctggtgctgaaattcttgtgggtacatgggtgccggcacttaacatatttgag
acaagtctgaggcgtggaaagtttgatgaatcacggaagctgccagatggatctcttatg
gatattgttaaagtctatccacttgatgctgtctacgattcccctgatgatgttcctgaa
gatgtcaaatcgaacaaaagatatgcaggggcatcaaactggacagtaaaggaagttgtt
gaatcagtgaggaatgattttggcagcattgacatactagtgcattctcttgctaatggc
ccagaggtaacgaagcctttgttggaaacctcaagaagaggctatcttgcggcaatttct
gcatccagttactcctatgtttcattgcttcagcacttccttcctataatgaatcccggt
ggtgctagcatctctctaacatacattgcatctgaaagggcgattcctgggtatggtggt
gggatgagttctgctaaagcagctcttgagagtgatacacgggtgcttgcattcgaagct
gggcgaaaaggcaaaatcagagttaacaccatatcagcaggccctcttgggagccgagct
gctaaggcaattggatttattgagaagatgatagagtactcatatgttaatgcaccattg
cagaaggagctgttggctgatgaggtggggaacacagctgcattcctggtttcttcattg
gcttctgccatcaccggctcgactgtttatgttgacaatgggctcaatacaatggggctt
gcaattgacagccctaccataacgtcatag

DBGET integrated database retrieval system