KEGG   Zea mays (maize): 100279930Help
Entry
100279930         CDS       T01088                                 

Gene name
TIDP3457
Definition
(RefSeq) uncharacterized protein LOC100279930
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
zma  Zea mays (maize)
Pathway
zma00020  Citrate cycle (TCA cycle)
zma00190  Oxidative phosphorylation
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100279930 (TIDP3457)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100279930 (TIDP3457)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100279930 (TIDP3457)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100279930
NCBI-ProteinID: NP_001146352
UniProt: B8A0Q6
LinkDB All DBs
Position
7
AA seq 619 aa AA seqDB search
MWRSCVSRGLSRAKASASRLLSTASSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNT
ACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAP
KAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQ
AMKHNTQFFVEYFALDLLMDNEGKCQGIIALNMEDGTLHRFRASNTILATGGYGRAYFSA
TSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERF
MERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISET
AAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDAVVPGLMAAGEAACAS
VHGANRLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGS
LPTSKIRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDQSLIWNSDLIET
LELENLLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLAYRPV
HMNTLDDEVESFPPKARVY
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcagctgcgtctcgcgaggcctctccagggccaaggcctccgcctccaggctc
ctctccacggcgtcgtcgtcctacacggtggtcgaccacacctacgacgcggtggtggtg
ggggccggcggcgcggggctccgggcggcgatcggcctctccgagcacggcttcaacacc
gcgtgcatcaccaagctcttccccacgcgctcgcacaccgtcgcggctcagggaggcata
aatgctgcacttggaaacatgagtgaagatgactggaggtggcatatgtatgacactgtt
aagggaagcgattggctgggtgaccaggattctattcagtatatgtgcagagaggcacca
aaagctgttatagagcttgagaactatggactaccattttcaagaactgaagagggaaag
atataccaacgtgcctttggagggcagagcttagattttggcaaaggtggacaagcctac
cgttgtgcctgcgctgctgacagaacaggacatgctatgctgcacacactatatggtcaa
gcaatgaagcacaacactcaattttttgtggaatactttgctttggaccttctcatggac
aatgaaggaaaatgtcagggaatcattgccttaaacatggaggatggaactcttcaccgt
ttccgtgcttctaatacaattctagccacaggaggttatggcagggcatatttctcagca
acctcagcacacacttgtactggagatggcaatgctatggttgcacgtgctggtttacct
ctccaggatcttgagtttgtacaattccatcctacaggcatttatggtgctggatgcctg
attactgaaggttcccgtggtgaaggtggtatccttagaaatagtgaaggtgaacggttc
atggaacgatatgctcctactgcaaaagatcttgcttctcgtgatgttgtttcaagatca
atgacaatggaaattagagaaggacgtggtgtagggccattgaaggatcacatttatttg
catctgaaccatctgccacctgaggttctcaaggaaaggcttcctggtatttctgaaact
gctgctatttttgctggtgttgatgtcaccaaggagcccattccagttttgcctactgtg
cactacaatatgggcggtattccaacaaactaccatggggaggtagtggatatcaagggt
gataatccagatgctgttgttcctggtctaatggctgctggtgaagcagcctgtgcatct
gttcatggtgcgaataggctaggcgcaaattcgcttcttgacatagttgtttttggcaga
gcttgtgcaaacagggtagcagatatttctaaaccaggtgagaagcagaaacctctggaa
aaagatgctggagaaaagaccatagcctggttggacaagctgaggaatgcgaatgggtca
ttgccaacttccaagatccgtctcaacatgcagcgtgttatgcaaaataatgctgctgta
ttccgtacacaagaaacacttgaagaaggttgtgagctgattagcaaaacatgggaaagt
ttccatgatgtgaagctcagtgaccagagtctcatttggaactctgacctgatagagacc
cttgagctggaaaatcttttgataaatgcatgcataaccatgtattcggcagaggctcgg
aaggaaagcagaggagctcatgctcgtgaggatttcacgacaagagatgacgagaagtgg
atgaagcactcactggggtactgggaaaacgagaaggttcgattggcatacaggccagtg
cacatgaacacattagacgatgaagtagagtccttcccgccgaaagcccgtgtctattga

DBGET integrated database retrieval system