KEGG   Zea mays (maize): 100282875Help
Entry
100282875         CDS       T01088                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20specific
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
zma  Zea mays (maize)
Pathway
zma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100282875
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100282875
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100282875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100282875
NCBI-ProteinID: NP_001149253
UniProt: B4FVH7
LinkDB All DBs
Position
2
AA seq 339 aa AA seqDB search
MVRVGLSSAPGVNLTEQIDNVFDQLINKIEHADFDTRPFLKQLNVLGRYEPIKRNVYCTK
RRIEDYGISCHCKPSPGSSVVCGRDCHCGMLFSCCSSQCECDDTCTNKSFQHRPLKKTKL
IKTEKCGHGLVAEDEIKKGEFVIEYVGEVIDDRTCENRLWTMKRLLDTDFYLCEVSSNMV
IDATNKGNRSRFINHSCEPNTAMQKWTVDGETRVGIFALRDIKIGEELTYDYKFVQFGAA
QVCHCGSSNCRKMLGTTKYSGSSQNHHAKKKKRKTSCENCIQQFLRLWHPHKKMYVGCWI
IDFDQETKMHTLKFNDLHTEKFNLKEEEWHFLEVDFDED
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgtgggcttgtcttccgcgcccggggtcaatctgacagagcaaatcgataat
gtttttgaccaactgatcaacaagatagaacatgcggattttgatacgcggcctttcttg
aaacaattgaatgtgttaggccgctatgaaccaatcaagcggaatgtatattgcactaag
agacgcattgaagattatggcatttcttgtcactgtaagccttctcctggttcatcagtt
gtgtgtggcagagactgccattgtggcatgcttttctcttgctgttcatcacaatgtgaa
tgtgatgacacatgcaccaataaatcattccagcacagacctcttaagaaaaccaaattg
attaagacagagaaatgtggtcatggattggttgctgaggatgaaataaagaaaggagaa
tttgttattgagtatgttggagaagttattgatgacagaacatgtgagaataggctatgg
acaatgaaaaggctgcttgacactgacttctacctttgtgaggtcagtagtaatatggtc
attgatgcaacaaacaagggaaaccggtcccgattcataaaccatagctgtgaaccaaac
acagcgatgcagaaatggactgttgatggagagaccagggttggaatttttgcacttcgt
gacataaagataggggaggagctgacctatgactataaatttgtccagtttggagcagct
caagtttgtcattgtgggtcttcgaactgcagaaaaatgctaggcacgacgaagtattca
ggaagctcacagaatcatcatgccaagaagaaaaagcggaaaacaagttgtgagaattgc
atacagcagtttcttcggctgtggcatccacataaaaaaatgtatgttggttgttggata
attgacttcgatcaagaaactaaaatgcatactctgaagttcaatgatctccatactgaa
aagttcaatttgaaggaagaagaatggcacttcttagaggtcgattttgatgaagattga

DBGET integrated database retrieval system