KEGG   Zea mays (maize): 100283066Help
Entry
100283066         CDS       T01088                                 

Gene name
sdh1
Definition
(RefSeq) sorbitol dehydrogenase homolog 1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
zma  Zea mays (maize)
Pathway
zma00040  Pentose and glucuronate interconversions
zma00051  Fructose and mannose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100283066 (sdh1)
   00051 Fructose and mannose metabolism
    100283066 (sdh1)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100283066 (sdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 AlaDh_PNT_C Sacchrp_dh_NADP Zn_ribbon_SprT UDPG_MGDP_dh_N Pyr_redox Pyr_redox_3 TrkA_N Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 100283066
NCBI-ProteinID: NP_001149440
UniProt: A0A1D6KL30
LinkDB All DBs
Position
1
AA seq 366 aa AA seqDB search
MGKGAQGSDAAAAGGEVEENMAAWLVAKNTLKIMPFKLPPVGPYDVRVRMKAVGICGSDV
HYLREMRIAHFVVKEPMVIGHECAGVVEEVGAGVMHLSVGDRVALEPGVSCWRCRHCKGG
RYNLCEDMKFFATPPVHGSLANQVVHPADLCFKLPDGVSLEEGAMCEPLSVGVHACRRAG
VGPETGVLVVGAGPIGLVSLLAARAFGAPRVVVVDVDDHRLAVARSLGADAAVRVSPRVE
DLADEVERIRAAMGSDIDVSLDCAGFSKTMSTALESTRPGGKVCLVGMGHNEMTLPLTAA
AAREVDVVGVFRYKDTWPLCIDFLRSGKVDVKPLITHRFGFSQRDVEEAFEVSARGRDAI
KVMFNL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggagcgcaagggagcgatgcggcggcggcgggcggcgaggtggaggagaac
atggcggcgtggctggttgccaagaacaccctcaagatcatgcccttcaagctcccgccc
gtcggcccttatgatgtccgcgtgcgcatgaaggcagtggggatttgcggcagcgatgtg
cactacctcagggagatgcgcatcgcgcacttcgtggtgaaggagccgatggtgatcggg
cacgagtgcgcgggcgtggtcgaggaggtgggcgccggcgtgatgcacctgtccgtgggc
gaccgcgtggcgctggagccgggcgtcagctgctggcgctgccgccactgcaagggcggg
cggtacaacctgtgcgaggacatgaagttcttcgccaccccgccggtgcacggctcgctg
gcgaaccaggtggtgcacccggccgacctgtgcttcaagctccccgacggtgtgagcctg
gaggagggcgccatgtgcgagccgctgagcgtgggcgtgcacgcgtgccgccgcgcgggg
gtggggcccgagacgggcgtgctcgtggtgggcgccggccccatcggcctggtgtcgctg
ctggcggcgcgggccttcggcgcgccgcgcgtggtggtcgtggacgtggacgaccaccgc
ctggccgtggccaggtcgctgggcgcggacgcggcggtgcgggtgtcgccccgcgtggag
gacctggcggacgaggtggagcgcatccgcgcggccatgggctcggacatcgacgtcagc
ctggactgcgccgggttcagcaagaccatgtcgacggcgctggagtcgacgcggcccggc
gggaaggtgtgcctggtcgggatgggccacaacgagatgacgctgcccctgacggcggcg
gcggcgcgggaggtggacgtggtgggcgtgttccggtacaaggacacctggccgctgtgc
atcgacttcctgcgcagcggcaaggtggacgtcaagccgctcatcacccaccgcttcggc
ttctcgcagcgggacgtggaggaggccttcgaggtcagcgcccgcggccgcgatgccatc
aaagtcatgttcaacctctag

DBGET integrated database retrieval system